SecReT6
Protein ID: 77459632
SecReT6 ID97
T6SS typei4a
Gene symbol-
Locus tagPfl01_3410
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T6SS(s) in this replicon]
Location [Strand]3888789..3890558 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ3KAQ6
KEGG IDpfo:Pfl01_3410
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.20E-176, Aligned region: 1..585
Protein Sequence: 589 a.a.     [Download]
>gi|77459632|ref|YP_349139.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MLDYYQRELTWLRHAGGQFAERYPKVARRLELSPGECPDPHVERLLEGFALLAARLQRRLDDDYAEFSDA
LLEQLYPLAMRPLPSCAIVQFEPDPSKGNLDGGYPLPRDTPLFVTTSKGESIHFRTSAAVRLWPVEVSEA
LLLGSDEAQALTGVAQSRSALRLSLRCLGDSQWSELGIEQLRIHLAASPVVNANLYDLLGAHAVQVLAGS
PGSIPARVKGLPKIVGFADDEVLLPDEDGVHPGMRLLAEYFAFPDKFHFFDLPLSGVSSDSQTLYLYIVF
DRAPAGRLHLQATEIALGCAPVINLFPRTSEPLRPDGTRSEYRLIADSHRENSVEIHSIRSMRASSASGV
QRLPAYFGSQHSSGDRQRYWHARRVNGQTPNRLGSDLLVSVVDTRFEPQTDLPDYSLTAELLCTNRHLAQ
SLPAGTPLGFERPGPVAWARLRNPPSPQSLPRLDGDSRWRLVSQLTLNHLSLVEGPQALDALKEILTLHN
LRDEASALRQIEGLLNLGCERVIGHVGADAWRGWRNGLEVQLQLDPQHFVGSSAVLFSAVLAQFFSVYAT
ANRFVRTVLMQADKEVKAWQPQAGMPLSL
 
Nucleotide Sequence: 1770 bp     [Download]
>gi|255961261|ref|NC_007492.2|:3888789-3890558 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
TTGCTCGACTACTACCAGCGCGAACTGACCTGGCTGCGACATGCCGGCGGACAGTTTGCCGAACGCTATC
CGAAAGTCGCGCGACGTCTGGAGTTGTCTCCCGGCGAATGCCCGGACCCACACGTCGAACGATTGCTGGA
AGGTTTTGCCCTGCTCGCCGCACGTCTGCAACGGCGGCTGGATGACGACTACGCCGAGTTCAGCGACGCA
TTGCTCGAACAGCTTTATCCCCTGGCCATGCGCCCGCTGCCGTCCTGCGCGATCGTCCAGTTCGAACCGG
ACCCGAGCAAAGGCAACCTCGACGGCGGCTATCCCCTGCCCCGGGACACGCCGTTGTTCGTCACCACCAG
CAAGGGCGAAAGCATTCACTTTCGCACCAGCGCCGCCGTGCGTTTGTGGCCGGTTGAAGTCAGCGAAGCG
TTGTTGCTGGGCAGCGATGAAGCCCAGGCGCTGACCGGTGTGGCGCAGTCCCGCTCGGCGTTGCGCCTGA
GTCTGCGTTGCCTCGGCGACAGTCAGTGGTCGGAGCTTGGCATCGAACAACTGCGCATTCACCTGGCCGC
GTCACCGGTGGTCAACGCCAACCTCTATGACCTGCTCGGCGCCCACGCGGTGCAGGTGTTGGCCGGCTCA
CCGGGGAGCATTCCCGCCCGCGTGAAAGGCCTGCCGAAGATCGTCGGTTTCGCCGACGACGAAGTGCTGC
TGCCGGACGAAGACGGCGTGCATCCGGGCATGCGTCTGCTGGCCGAATACTTCGCGTTCCCGGACAAATT
CCACTTCTTTGATCTGCCCCTGTCCGGTGTTTCGAGTGACAGCCAGACGCTGTATCTGTACATCGTTTTT
GACCGGGCGCCGGCCGGCCGATTGCACTTGCAGGCCACTGAAATCGCCCTCGGCTGTGCGCCGGTGATCA
ACCTGTTCCCGCGTACCTCGGAGCCGCTGCGTCCGGACGGCACCCGCAGCGAATATCGCCTGATCGCCGA
CAGCCACCGTGAAAACAGCGTCGAAATCCACAGCATTCGCAGCATGCGCGCCAGCTCCGCCAGCGGGGTG
CAACGGCTGCCGGCGTATTTCGGCAGCCAGCACAGCAGCGGTGACCGGCAACGTTACTGGCATGCGCGGC
GAGTCAACGGACAGACGCCGAACCGGCTCGGCAGCGATCTGCTGGTCAGCGTCGTCGACACCCGTTTCGA
ACCGCAGACCGACCTGCCCGATTACAGCCTGACCGCCGAACTGCTGTGCACCAATCGGCATCTGGCCCAG
AGCCTGCCCGCCGGTACGCCGCTGGGTTTCGAACGGCCGGGTCCGGTGGCGTGGGCACGCTTGCGCAATC
CGCCGAGCCCGCAAAGCCTGCCGCGACTGGACGGTGATTCGCGCTGGCGGCTAGTGTCGCAACTGACCCT
CAATCACCTGTCGCTGGTCGAAGGGCCGCAGGCGCTGGATGCGCTGAAGGAAATCCTGACCCTGCACAAC
CTGCGCGACGAGGCCAGCGCCCTGCGCCAGATCGAAGGATTGCTGAACCTTGGTTGCGAGCGGGTGATCG
GCCATGTCGGCGCCGACGCCTGGCGCGGCTGGCGCAACGGGCTTGAAGTGCAATTGCAGCTTGATCCACA
GCATTTCGTCGGCAGCAGCGCGGTGTTGTTTTCAGCGGTGCTCGCGCAGTTCTTTTCGGTGTACGCCACG
GCCAATCGCTTTGTGCGCACGGTGCTCATGCAGGCAGACAAGGAGGTCAAGGCATGGCAACCCCAAGCCG
GCATGCCCCTGTCGCTCTGA