SecReT6
Protein ID: 77459633
SecReT6 ID97
T6SS typei4a
Gene symbol-
Locus tagPfl01_3411
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T6SS(s) in this replicon]
Location [Strand]3890522..3891547 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ3KAQ5
KEGG IDpfo:Pfl01_3411
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.90E-80, Aligned region: 20..321
Protein Sequence: 341 a.a.     [Download]
>gi|77459633|ref|YP_349140.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MATPSRHAPVALTLSQRLRRDPQAFEWLQALLLLEREQPQADALGSGTSPQAEALKLRGPLTPLFAASQI
ESLEENPGEPLTLNSPMFGLGGPDGPLPYAYQEWLQQRARAKDHAPAEFLDLFQHRLLSLLYKVMRKHRI
ALGFTTPGASPVQAQLRALTGLLPKSLQERQAVPDCAVLACTALYADGRRSLAGFAAIVREQFAVAVELS
AYEGAWREIPRASRSVMKAGGRNLQLGRSAVAGTRVWDEHAGIRLTLGPLPSTQAARFLPDGEAHPALAS
LAALYFGPDLDVKLVLLVRGAGPLQLGRQTPALLSWNGGLQRQTSLAVQRIETRLRQLEIT
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|255961261|ref|NC_007492.2|:3890522-3891547 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
ATGGCAACCCCAAGCCGGCATGCCCCTGTCGCTCTGACCCTGAGCCAGCGCCTGCGCCGTGATCCGCAGG
CGTTCGAATGGTTGCAGGCGCTGCTGTTGCTGGAGCGTGAACAGCCGCAGGCCGACGCCCTCGGCTCGGG
GACATCGCCACAGGCCGAAGCGCTGAAATTGCGCGGGCCGCTGACGCCATTATTCGCCGCCAGTCAGATC
GAAAGCCTGGAGGAAAACCCCGGTGAACCGCTGACCCTGAACTCGCCGATGTTCGGCCTCGGCGGCCCCG
ACGGCCCGCTGCCTTACGCTTATCAGGAATGGCTGCAACAACGGGCGCGGGCCAAGGATCATGCGCCCGC
CGAGTTCCTCGACCTGTTCCAGCATCGGCTGCTGAGCCTGCTGTACAAGGTGATGCGCAAACACCGGATC
GCCCTCGGTTTCACCACGCCCGGCGCCTCGCCAGTGCAGGCGCAACTGCGGGCGCTGACCGGGTTGTTGC
CCAAATCCCTGCAAGAACGCCAGGCGGTTCCCGACTGCGCCGTTCTGGCCTGCACGGCGTTGTACGCCGA
TGGCCGCCGGTCGTTGGCGGGGTTCGCGGCGATTGTCCGCGAGCAATTTGCCGTGGCGGTGGAACTGAGC
GCTTATGAAGGGGCGTGGCGTGAAATTCCACGCGCCAGCCGCAGCGTCATGAAGGCCGGCGGACGCAATC
TGCAACTCGGCCGTAGCGCTGTCGCCGGTACTCGGGTCTGGGATGAACATGCCGGAATTCGTCTGACGCT
GGGGCCGCTGCCATCGACGCAGGCCGCGCGCTTCTTGCCGGACGGCGAAGCGCATCCGGCACTGGCGAGC
CTCGCTGCGCTGTATTTCGGCCCGGATCTAGACGTGAAACTGGTGCTGCTGGTGCGCGGTGCGGGGCCGC
TGCAACTCGGCCGACAAACCCCGGCCCTGTTGAGCTGGAACGGTGGCCTGCAACGGCAGACCAGCCTGGC
CGTGCAACGGATCGAAACCCGCCTGCGTCAGCTGGAGATCACCTGA