SecReT6
Protein ID: 77459637
SecReT6 ID97
T6SS typei4a
Gene symbol-
Locus tagPfl01_3415
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T6SS(s) in this replicon]
Location [Strand]3895804..3897813 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ3KAQ1
KEGG IDpfo:Pfl01_3415
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.70E-70, Aligned region: 44..324
Phage_base_V [PF04717], Evalue: 1.00E-22, Aligned region: 352..445
Gp5_C [PF06715], Evalue: 2.30E-12, Aligned region: 490..501
Gp5_C [PF06715], Evalue: 2.30E-12, Aligned region: 502..524
Gp5_C [PF06715], Evalue: 2.30E-12, Aligned region: 537..558
Gp5_C [PF06715], Evalue: 2.30E-12, Aligned region: 561..584
Gp5_C [PF06715], Evalue: 2.30E-12, Aligned region: 587..606
Gp5_C [PF06715], Evalue: 2.30E-12, Aligned region: 642..655
Protein Sequence: 669 a.a.     [Download]
>gi|77459637|ref|YP_349144.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MPRSTDSTTTLSLTATSLSALYPESLSGDEALNALSAQILNGLNDGTSLTLTSAIATHVTTTLHNDAQLR
PFDALVAEIRQLPADATAERYKLVLRPWLWWLTLASNNRVFQNLVTSDIVTSIFKAHGFTDFKLSLTGSY
TPREYCVQYGETDFAFVSRLLEEEGIFWFFTHEDGKHTLVLGDSNDAFVQIPNGPKVKYLGQQLGERELH
GIRSGQVCLQAVAGVYKATDYEFTTPTTSLYGQAEAVAGPRSIYEHPGGYNAKARGDALTKQRVDGLRSE
EKRFVGESDCRWLIPGHWFTLDGHEDASLNIDWVVTRVTHDASHESYRNRFEAIPKATPFRPQRLTPKPR
MHPQTAIVVGKSGEEIWTDEYGRIKLQFPWDRDGKNDETSSCWVRVVLPWSGKGFGMQFVPRIGQEVIVT
FIDGDPDRPLVTGCVYNGDNALPYALPANQTQSGIKTQSSKGGGGFNELRFEDKKDAEEVFLQAQKDLKI
NVLNDTTATVGHDETLTVQNARTRTVKDGDETVTLEKGKRSVTIQTGSDSLDVKDSRTVKVGADQNHSTG
GNYTDKVTGDYSLTVDGNLTIKVSGTLTLQSGGSFTIKSGADLATSASTSITQKAGTAMTNQAGTSLDNK
AGTTLTNDAGISLTNKGAASQTVDGGGMLTIKGGLVQVN
 
Nucleotide Sequence: 2010 bp     [Download]
>gi|255961261|ref|NC_007492.2|:3895804-3897813 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
ATGCCCCGCTCCACCGACAGCACCACCACCCTCTCCCTCACCGCCACTTCGCTGTCGGCGCTTTACCCTG
AGTCGCTGTCGGGTGATGAAGCGCTCAACGCACTAAGCGCACAAATCCTCAACGGACTCAACGACGGTAC
CTCCCTCACCCTGACCAGTGCCATCGCCACCCACGTCACCACCACCCTGCACAACGACGCCCAACTTCGC
CCGTTCGACGCTCTGGTCGCCGAAATCCGCCAGCTCCCCGCCGACGCGACCGCCGAACGCTATAAGCTGG
TTCTAAGGCCATGGCTCTGGTGGCTGACCCTGGCCAGCAACAACCGGGTATTCCAGAACCTCGTCACCTC
GGACATCGTCACTTCGATCTTCAAAGCTCACGGTTTCACCGATTTCAAACTCTCACTGACCGGCAGCTAC
ACCCCACGCGAATACTGCGTGCAGTACGGCGAAACCGATTTCGCCTTCGTCTCGCGCCTGCTGGAGGAGG
AAGGCATTTTCTGGTTCTTCACCCACGAGGACGGCAAGCACACGCTGGTGCTGGGTGATAGCAACGACGC
CTTCGTGCAGATCCCCAACGGGCCGAAGGTCAAATACCTGGGCCAGCAATTGGGTGAGCGCGAATTGCAT
GGCATCCGCTCAGGCCAGGTGTGCCTGCAAGCGGTGGCCGGCGTGTACAAGGCAACGGATTACGAATTCA
CCACACCAACCACTTCACTCTATGGCCAGGCCGAAGCCGTCGCCGGGCCGCGTTCGATCTATGAGCATCC
GGGTGGTTACAACGCCAAGGCTCGGGGCGATGCATTGACCAAACAACGGGTAGACGGGCTTCGCAGTGAA
GAGAAACGCTTTGTTGGCGAAAGCGACTGCCGCTGGCTGATTCCAGGCCACTGGTTCACCCTCGACGGCC
ACGAAGACGCGAGCCTGAACATCGACTGGGTCGTCACTCGGGTGACCCATGACGCCAGCCACGAAAGCTA
TCGCAATCGCTTCGAGGCGATCCCCAAGGCCACGCCGTTTCGTCCGCAACGCCTCACGCCCAAACCGCGC
ATGCACCCGCAGACCGCCATCGTAGTCGGCAAGTCCGGCGAGGAAATCTGGACCGACGAATACGGCCGGA
TCAAGTTGCAGTTCCCGTGGGATCGCGACGGCAAGAACGATGAAACCAGTTCCTGCTGGGTGCGCGTGGT
GCTGCCGTGGAGCGGCAAGGGTTTCGGCATGCAGTTCGTGCCGCGCATCGGTCAGGAGGTCATCGTCACC
TTCATCGACGGCGATCCGGACCGGCCGCTGGTCACCGGGTGCGTCTACAACGGCGATAACGCCCTGCCCT
ATGCCTTGCCGGCGAACCAGACACAGTCGGGGATCAAGACTCAATCGTCCAAGGGCGGCGGTGGGTTCAA
CGAGCTGCGTTTCGAGGACAAGAAAGACGCCGAGGAAGTGTTCCTGCAAGCGCAGAAAGATCTGAAGATC
AACGTGCTCAACGACACCACCGCCACCGTCGGCCACGACGAAACCCTCACGGTGCAGAACGCCCGCACCC
GTACGGTCAAGGACGGCGATGAAACCGTGACGCTGGAGAAAGGCAAACGCAGCGTCACGATCCAGACCGG
CAGCGATAGCCTCGATGTAAAGGACAGCCGCACAGTGAAAGTCGGCGCCGACCAGAACCACAGCACCGGC
GGCAACTACACCGACAAGGTCACCGGCGATTACAGCCTGACGGTGGACGGCAACCTGACGATCAAGGTCA
GCGGCACCCTCACCCTGCAAAGCGGCGGCAGTTTCACGATCAAGAGCGGTGCAGATCTGGCGACTTCGGC
CAGCACTTCGATCACCCAGAAGGCCGGCACCGCCATGACCAATCAGGCCGGTACTTCACTGGACAACAAA
GCCGGGACGACGCTGACCAACGACGCCGGCATCAGCCTGACCAACAAGGGCGCGGCCTCACAGACCGTGG
ACGGCGGCGGCATGCTGACCATCAAGGGCGGGCTGGTGCAGGTCAACTGA