SecReT6
Protein ID: 77461795
SecReT6 ID98
T6SS typei1
Gene symbol-
Locus tagPfl01_5574
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T6SS(s) in this replicon]
Location [Strand]6242365..6244590 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ3K4J3
KEGG IDpfo:Pfl01_5574
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.40E-66, Aligned region: 29..326
Phage_base_V [PF04717], Evalue: 2.50E-24, Aligned region: 375..468
DUF2345 [PF10106], Evalue: 1.90E-05, Aligned region: 538..572
DUF2345 [PF10106], Evalue: 1.90E-05, Aligned region: 581..622
Protein Sequence: 741 a.a.     [Download]
>gi|77461795|ref|YP_351302.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MFNPANETHFSLTVEDYVGDLQVLSFTGTEGISQPFRFDIELVSENPDLDLEKLLHKQAFLALDPQGSGI
HGQIYRVAQGDAGKRLTRYKVSLVPQLQYLHHRTNQRIYQQMSAPKIIALILDEHGIKGNAYSFQLSQPC
PDRDYCVQYDETDLHFVQRLCEEEGIHYHFQHSKKGHLLVFGDDQTVFPNLGQPTAYVQGSGMVAEEPVI
KGFKLRLETRTSRTTRRDYDFEKPRLQMEAAYKPDGESTEPDLEDYDYPGRFIDRARGKFLSQRALERHR
ADYRQAEGRGDQTRLVSGHFMEMSDHPRSEWNDLWLLTEIFHEGKQPQVLEESVTSDTTDNKDDFHQGYR
NRFLATPWDVFYRPALEHPKPRVLGSQTAMVTGPKGEEIHCDQYGRIKVQFHWDREGLADDKTSCWLRVS
SSWAGDRYGAISIPRIGMEVLVTFLEGDPDQPLVTGCLYHKENPVPYALPANKTRSVFKTLSSPGGGGYN
ELRIEDKKGAEQIFIHAQRDWDENVEHDQKIRVGNERHDTVVKNSYTELKAEEHRTTISDRKIEAKADDH
LTVGESQHIKLGTAQLTSVGKEIHLKSGDKMVIEAGTELTILGGGSFIKLDGGGVTVVGPVVKINAGGSA
GSGTGIGILAPVIPLIADQARAGNTLKSGTANSPKYDEQIRFVTGLGQPIKSVKAAIIVPSSVAPKISKS
NADGLHPRVVTDSEETAEVHLMWDELIVPEGSDDYEASRNK
 
Nucleotide Sequence: 2226 bp     [Download]
>gi|255961261|ref|NC_007492.2|:c6244590-6242365 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
ATGTTCAACCCAGCTAACGAAACGCACTTCAGCCTGACCGTTGAAGATTACGTAGGCGACCTGCAAGTCC
TGTCGTTCACCGGCACCGAAGGCATCAGCCAGCCGTTCCGTTTCGACATCGAACTGGTCAGCGAAAACCC
GGATCTGGACCTGGAAAAGCTCCTGCACAAACAGGCCTTCCTCGCCCTCGATCCGCAGGGCTCGGGTATC
CACGGCCAGATCTACCGCGTGGCCCAGGGCGATGCCGGCAAGCGCCTGACCCGCTACAAAGTCTCGCTGG
TGCCGCAGCTGCAATACCTGCATCACCGCACCAACCAGCGCATCTACCAGCAGATGTCGGCGCCGAAAAT
CATCGCACTGATCCTCGACGAGCACGGCATCAAGGGCAACGCCTACAGCTTTCAGTTGAGCCAGCCGTGC
CCGGACCGCGACTACTGCGTGCAGTACGACGAAACCGATCTGCACTTCGTCCAGCGCCTGTGCGAAGAAG
AGGGGATTCACTACCACTTCCAGCACAGCAAGAAAGGTCATCTGCTGGTGTTCGGCGATGACCAGACCGT
GTTCCCCAACCTCGGACAACCGACCGCGTATGTACAGGGCAGCGGCATGGTCGCCGAAGAACCGGTGATC
AAAGGCTTCAAGCTGCGTCTGGAAACCCGCACCAGCCGCACCACCCGCCGCGACTACGATTTCGAGAAAC
CGCGCCTGCAAATGGAGGCGGCGTACAAACCGGACGGCGAGAGCACTGAACCGGATCTCGAAGACTACGA
CTACCCCGGCCGTTTCATCGACCGCGCGCGCGGCAAGTTCCTCAGCCAGCGCGCCCTCGAACGCCACCGT
GCCGACTACCGCCAGGCCGAAGGTCGCGGTGACCAGACCAGACTCGTCAGCGGCCACTTCATGGAAATGT
CCGACCACCCGCGCAGCGAGTGGAACGACCTGTGGCTGCTCACCGAAATTTTCCACGAAGGCAAACAGCC
GCAAGTCCTCGAAGAATCGGTGACCAGCGACACCACCGACAACAAGGACGACTTCCACCAGGGCTACCGC
AACCGCTTCCTCGCCACCCCGTGGGACGTGTTCTACCGCCCCGCGCTCGAACACCCGAAACCCCGCGTGC
TCGGCAGCCAGACCGCGATGGTCACCGGCCCCAAAGGCGAAGAAATCCACTGCGACCAATACGGCCGCAT
CAAAGTGCAATTCCACTGGGACCGCGAAGGCCTGGCCGACGACAAAACCAGCTGCTGGCTGCGCGTCTCC
AGCTCCTGGGCCGGCGACCGCTACGGCGCCATCTCCATCCCGCGCATCGGCATGGAAGTCCTCGTCACCT
TCCTCGAAGGCGACCCCGATCAACCGCTGGTCACCGGCTGCCTGTACCACAAGGAAAACCCGGTGCCGTA
CGCCTTGCCGGCAAACAAAACCCGCAGCGTCTTCAAAACCCTCAGCTCCCCGGGCGGCGGTGGCTACAAC
GAACTGCGCATCGAAGACAAAAAAGGCGCCGAACAGATATTCATCCACGCCCAGCGGGACTGGGATGAAA
ACGTTGAGCACGACCAGAAGATTCGCGTCGGGAATGAACGTCACGACACGGTGGTGAAGAACAGCTACAC
CGAGCTCAAGGCAGAAGAACACCGCACCACCATAAGCGACCGCAAGATCGAAGCGAAAGCCGACGATCAC
CTGACGGTAGGAGAAAGCCAGCACATCAAGCTCGGTACCGCCCAGTTGACCAGTGTGGGGAAAGAGATCC
ACCTGAAGTCTGGCGACAAGATGGTGATTGAGGCTGGCACCGAACTGACCATTCTGGGCGGTGGGAGCTT
TATCAAGCTCGATGGCGGTGGTGTGACGGTGGTTGGACCGGTGGTGAAGATCAATGCCGGAGGCTCGGCG
GGAAGCGGTACGGGGATTGGCATTCTGGCACCGGTCATTCCGCTGATTGCGGATCAGGCTAGGGCGGGGA
ACACACTGAAGTCTGGTACTGCCAATAGTCCGAAGTATGACGAACAAATCCGTTTTGTGACCGGGCTCGG
TCAACCCATAAAGTCTGTGAAGGCAGCGATTATTGTCCCTTCGTCGGTCGCTCCTAAAATCTCCAAAAGC
AACGCAGATGGTCTGCATCCGCGTGTGGTGACTGACAGCGAGGAAACCGCTGAGGTCCATCTGATGTGGG
ACGAACTCATCGTGCCGGAAGGCTCCGACGATTACGAAGCGAGTAGAAATAAATGA