SecReT6
Protein ID: 77461799
SecReT6 ID98
T6SS typei1
Gene symbol-
Locus tagPfl01_5578
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T6SS(s) in this replicon]
Location [Strand]6249898..6250773 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ3K4I9
KEGG IDpfo:Pfl01_5578
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.20E-69, Aligned region: 61..266
Protein Sequence: 291 a.a.     [Download]
>gi|77461799|ref|YP_351306.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MIKDMEHNQDDKTVLLDRQGHGPAASPLTDFAAPPRFEQLEERMIYAARLRPAEAFNISLNSLVAASSEL
LSEVVRLKHSETREDLYALNERLTAGLKLFEVRALHNGAESSQVMAARYVLCTVVDEAVVTTPWGNESEW
SQMSLLSSFHNETFGGEKFFQLLDRLSKNPVKHLPMLELMYLCLSLGFEGKYRVQARGMLELEGIRDALY
RQIRQLRGDVPRELSPQWEGLNDQRRNLVRIVPAWMVVLFTFVCLVMMYSGFAWVLGEQRDTVLQPYQPL
DPAAAQPQSQP
 
Nucleotide Sequence: 876 bp     [Download]
>gi|255961261|ref|NC_007492.2|:c6250773-6249898 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
ATGATCAAGGACATGGAACACAACCAGGACGACAAAACCGTCCTGCTCGACCGTCAGGGCCATGGCCCTG
CGGCGAGTCCGCTGACCGACTTCGCCGCGCCGCCGCGCTTCGAACAACTGGAAGAACGGATGATCTACGC
CGCGCGCCTGCGCCCGGCGGAGGCCTTCAATATCAGCCTCAATTCGCTGGTGGCCGCGTCGTCCGAACTG
CTGTCGGAAGTGGTGCGCCTCAAACACAGCGAAACCCGCGAAGACCTCTACGCGCTCAACGAGCGCCTGA
CCGCCGGGCTCAAGCTGTTTGAAGTGCGCGCCCTGCACAACGGCGCCGAAAGCAGCCAGGTGATGGCCGC
CCGTTACGTGCTCTGCACCGTGGTCGACGAAGCCGTCGTGACCACGCCGTGGGGCAACGAGAGCGAGTGG
TCGCAGATGAGCCTGCTCAGCAGCTTCCACAACGAAACCTTCGGTGGCGAGAAGTTCTTCCAGCTGCTCG
ATCGGCTGTCGAAAAACCCGGTCAAGCACCTGCCGATGCTGGAGCTGATGTACCTGTGCCTGTCCCTCGG
TTTCGAGGGCAAGTACCGCGTGCAGGCGCGCGGCATGCTGGAACTCGAAGGCATCCGCGACGCCCTGTAC
CGGCAGATCCGTCAGTTGCGTGGCGATGTGCCGCGCGAATTGTCGCCGCAGTGGGAAGGCCTCAACGATC
AGCGCCGCAATCTGGTGCGCATCGTGCCGGCGTGGATGGTGGTGCTGTTCACTTTCGTCTGTCTGGTGAT
GATGTATTCGGGCTTCGCCTGGGTCTTGGGCGAGCAGCGCGACACCGTTCTGCAACCTTATCAGCCGCTT
GATCCGGCCGCGGCCCAGCCGCAGTCGCAGCCGTAA