SecReT6
Protein ID: 77461800
SecReT6 ID98
T6SS typei1
Gene symbol-
Locus tagPfl01_5579
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T6SS(s) in this replicon]
Location [Strand]6250779..6252110 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ3K4I8
KEGG IDpfo:Pfl01_5579
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.90E-143, Aligned region: 18..442
Protein Sequence: 443 a.a.     [Download]
>gi|77461800|ref|YP_351307.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MNTHKVIWQEGMLLRPQHFQHNDRYYDHQMKTRTQLLGGYTWGFLNLEIDLQFLNMGKLVISEASGILPD
GSLFELGGNTEPLALDVPPNTGNMPIYLALPLVTGNHIEARRPEQSDVLARYTAYDAEVADSNAGDDSAS
QVSCGRPDFKLLLGEQQSDQAYVKLKICDVLDTTPDGVISLDPDFVPTYIQAHASSYLLSCLKEVISMLG
HRGDTIAERIRSNGKVGGAEIGDFMMLQLINRTELLLRHYLGLEQVHPEELYRTLLTMLGDLATFSSDSK
RPRLDSRYSHADQGASFRKLMESIRQVLSMVLEQHAIELILQARQYGIIVSPLHDHKLLGSASFVLAASA
NCDSEELRNRLPAHLKVGPVERIRQLVNLHLPGIKVKPLPVAPRQIAFHSNKTYFILELSSEDLAQLERS
GGFAFHVSGEFAELELKFWAIRN
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|255961261|ref|NC_007492.2|:c6252110-6250779 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
ATGAATACCCATAAAGTCATCTGGCAGGAAGGCATGCTGCTGCGCCCGCAGCACTTCCAGCACAACGACC
GCTACTACGATCACCAGATGAAGACCCGCACCCAGTTGCTGGGCGGCTACACCTGGGGTTTCCTGAATCT
GGAGATCGACCTGCAGTTCCTCAACATGGGCAAACTGGTGATCAGTGAAGCCTCGGGGATCCTGCCGGAC
GGCAGCCTGTTCGAACTCGGTGGCAACACCGAGCCGCTGGCGCTGGACGTACCGCCGAACACCGGCAACA
TGCCGATCTACCTGGCGCTGCCGCTGGTCACCGGTAACCACATCGAGGCCCGGCGCCCGGAGCAGTCCGA
TGTGCTGGCGCGCTACACCGCATATGACGCCGAAGTCGCCGACTCCAACGCCGGTGATGATTCCGCCAGC
CAGGTCAGTTGCGGCCGCCCGGACTTCAAGCTGTTGCTCGGCGAGCAGCAGAGTGACCAGGCTTACGTGA
AGCTGAAGATCTGCGATGTGCTCGACACCACGCCGGACGGCGTGATCAGCCTCGATCCGGATTTCGTGCC
GACCTACATTCAGGCCCACGCCTCCAGCTACCTGCTGTCGTGCCTGAAAGAAGTGATCAGCATGCTCGGC
CACCGGGGCGACACCATTGCCGAGCGCATTCGTTCGAACGGCAAGGTCGGCGGCGCGGAAATCGGCGACT
TCATGATGCTGCAACTGATAAACCGCACCGAACTGCTGCTGCGCCACTACCTGGGCCTGGAGCAGGTTCA
CCCGGAAGAGTTGTATCGTACGCTGCTGACCATGCTCGGCGATCTGGCGACGTTCTCCAGCGACAGCAAA
CGCCCGCGTCTGGACAGCCGCTACTCCCACGCCGATCAGGGCGCGAGCTTCCGCAAACTGATGGAGTCGA
TCCGTCAGGTGCTGTCGATGGTGCTGGAACAGCACGCCATCGAACTGATCCTGCAAGCGCGTCAGTACGG
GATCATCGTGTCGCCGCTGCACGACCACAAACTGCTGGGCTCGGCGTCGTTCGTGCTGGCAGCCAGTGCC
AACTGCGACTCCGAAGAACTGCGCAACCGCTTGCCTGCGCACCTCAAGGTCGGCCCGGTGGAGCGCATCC
GCCAACTGGTCAACCTGCACCTGCCGGGGATCAAGGTCAAACCGTTGCCGGTGGCCCCGCGGCAGATCGC
GTTCCACTCCAACAAAACCTATTTCATCCTCGAACTCAGTTCCGAAGACCTGGCACAACTCGAGCGCTCC
GGCGGCTTCGCGTTCCATGTGTCCGGCGAATTCGCCGAGCTTGAACTGAAATTCTGGGCCATCAGGAACT
GA