SecReT6
Protein ID: 77461801
SecReT6 ID98
T6SS typei1
Gene symbol-
Locus tagPfl01_5580
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T6SS(s) in this replicon]
Location [Strand]6252113..6252613 [-]
Productlipoprotein
NoteTssJ
UniProt IDQ3K4I7
KEGG IDpfo:Pfl01_5580
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.70E-43, Aligned region: 18..154
Protein Sequence: 166 a.a.     [Download]
>gi|77461801|ref|YP_351308.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MSRRSTAFFKTLTALTLLVLLAGCSSLSPYSKVTKINLKLTGSDQLNPDLNGRPSPIVVRLFELKHPVTF
ENADFFSLYERAKESLNPDLVASEELELRPGETVELKLSVEEGSRFIGILAAYRDLPETKWRHTFPITPL
EVTEADLTLDQAGIRKTNEVLAKADD
 
Nucleotide Sequence: 501 bp     [Download]
>gi|255961261|ref|NC_007492.2|:c6252613-6252113 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
ATGTCTCGCCGCTCGACCGCTTTTTTCAAGACGCTGACCGCGCTCACCCTGTTGGTGCTGCTCGCCGGTT
GCTCGTCGCTGTCGCCGTATTCGAAAGTGACCAAGATCAACCTGAAGCTGACCGGCAGCGATCAATTGAA
CCCGGACCTCAACGGTCGTCCGTCGCCGATCGTGGTGCGCCTGTTCGAACTCAAGCACCCGGTGACGTTC
GAGAACGCCGATTTCTTCAGCCTCTACGAGCGCGCGAAGGAATCCCTCAACCCGGATCTGGTGGCCAGCG
AAGAACTCGAACTGCGCCCGGGTGAAACCGTGGAGCTGAAACTCAGTGTGGAGGAGGGCAGCCGCTTCAT
CGGCATCCTCGCCGCGTACCGTGACCTGCCGGAAACCAAATGGCGCCACACGTTCCCGATCACACCGCTG
GAAGTCACCGAAGCCGATCTGACCCTGGATCAGGCCGGTATCCGCAAGACCAACGAAGTGCTCGCCAAGG
CGGATGACTGA