SecReT6
Protein ID: 77461802
SecReT6 ID98
T6SS typei1
Gene symbol-
Locus tagPfl01_5581
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T6SS(s) in this replicon]
Location [Strand]6252619..6253812 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDQ3K4I6
KEGG IDpfo:Pfl01_5581
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 2.80E-12, Aligned region: 29..97
Protein Sequence: 397 a.a.     [Download]
>gi|77461802|ref|YP_351309.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MELVFEMLNTKQFVPTELCQRTFKQAGGVIGRGEDCDWIIPDRKRHLSNHHAIVSYREGTFFLTDTSSNG
VQDGDSGARLHKGEPVRIEHGSTYVLGDFEIRARLVRDPATFDGEVGLPRAAGSIIPDDAFLDLDPLKSL
EQQERVYSEFEEMLAPVTDPEDSRQRADYARIDMESLMVPELIVEPKPEPAPAPKAVERQSETFWDKFGA
ALGVNVKNLSHDEREALALNAARLLRQSIGGLQQSLRTRSELKNELRLAQTTVQGTNKNPLKFAVDPSEA
LDILLQPNKPGHLPAEQAISRAFRDLQAHQVALLTASRAAVRGTLEHFSPEQLTLRFERDNKPLLATAGG
RWRAFNRYHHALRQDDDWSERLLARDFAQAYEEQIRLISTLHTDHQG
 
Nucleotide Sequence: 1194 bp     [Download]
>gi|255961261|ref|NC_007492.2|:c6253812-6252619 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
ATGGAATTGGTTTTCGAAATGCTGAACACCAAGCAGTTCGTGCCCACCGAGCTGTGCCAGCGGACCTTCA
AACAGGCCGGTGGCGTGATCGGGCGGGGCGAGGACTGCGATTGGATCATCCCTGACCGCAAGCGTCACTT
GTCCAACCACCACGCGATCGTTAGCTATCGCGAGGGTACGTTTTTCCTGACCGACACCAGCAGCAACGGT
GTTCAGGACGGCGACAGCGGCGCACGCCTGCACAAGGGCGAACCGGTGCGCATCGAGCACGGCAGCACCT
ACGTGCTGGGCGACTTCGAGATTCGCGCGCGCCTGGTGCGCGACCCGGCGACCTTCGACGGTGAAGTCGG
CCTGCCACGCGCCGCCGGCAGCATCATTCCGGACGATGCGTTTCTCGACCTCGATCCGCTGAAGTCGCTG
GAGCAGCAAGAGCGCGTGTACTCGGAGTTCGAGGAAATGCTCGCACCGGTGACCGACCCTGAAGACTCCC
GTCAGCGCGCCGACTATGCGCGTATCGACATGGAAAGCCTGATGGTGCCGGAGCTGATCGTCGAGCCCAA
GCCTGAGCCTGCACCGGCACCGAAAGCAGTCGAGCGCCAGAGCGAAACCTTCTGGGACAAATTCGGCGCG
GCCCTCGGCGTGAACGTGAAGAACCTCAGCCACGACGAGCGTGAAGCTCTTGCGCTGAACGCTGCTCGTC
TGCTGCGCCAGAGTATCGGCGGTCTGCAACAGAGCCTGCGCACCCGTTCCGAGCTGAAGAACGAGCTGCG
TCTGGCCCAGACCACCGTGCAAGGCACCAACAAGAATCCGCTGAAATTCGCCGTCGACCCGAGCGAAGCG
CTGGACATCCTGTTGCAGCCGAACAAACCGGGCCACTTGCCGGCCGAGCAGGCGATTTCCCGCGCGTTCC
GCGATTTGCAGGCGCATCAGGTGGCGCTGCTGACCGCCAGCCGCGCGGCGGTACGCGGCACTCTGGAGCA
CTTCTCGCCGGAGCAGTTGACCCTGCGTTTCGAGCGCGACAACAAGCCGTTGCTCGCCACCGCTGGCGGG
CGCTGGAGAGCGTTCAACCGTTACCACCACGCGCTGCGTCAGGACGACGACTGGAGCGAGCGCCTGCTGG
CCCGCGACTTCGCCCAGGCCTACGAAGAACAGATCCGCCTGATCTCCACCCTCCACACCGACCACCAAGG
ATGA