SecReT6
Protein ID: 77461805
SecReT6 ID98
T6SS typei1
Gene symbol-
Locus tagPfl01_5584
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T6SS(s) in this replicon]
Location [Strand]6255602..6258259 [-]
ProductClpB protein
NoteTssH
UniProt IDQ3K4I3
KEGG IDpfo:Pfl01_5584
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.70E-45, Aligned region: 207..285
AAA_2 [PF07724], Evalue: 2.70E-45, Aligned region: 619..784
AAA [PF00004], Evalue: 2.70E-20, Aligned region: 209..340
AAA [PF00004], Evalue: 2.70E-20, Aligned region: 624..747
AAA_5 [PF07728], Evalue: 2.50E-13, Aligned region: 209..232
AAA_5 [PF07728], Evalue: 2.50E-13, Aligned region: 451..483
AAA_5 [PF07728], Evalue: 2.50E-13, Aligned region: 623..741
ClpB_D2-small [PF10431], Evalue: 1.30E-12, Aligned region: 754..773
ClpB_D2-small [PF10431], Evalue: 1.30E-12, Aligned region: 795..863
AAA_16 [PF13191], Evalue: 4.10E-09, Aligned region: 8..93
AAA_16 [PF13191], Evalue: 4.10E-09, Aligned region: 187..232
AAA_16 [PF13191], Evalue: 4.10E-09, Aligned region: 253..287
AAA_16 [PF13191], Evalue: 4.10E-09, Aligned region: 594..660
AAA_16 [PF13191], Evalue: 4.10E-09, Aligned region: 688..717
AAA_16 [PF13191], Evalue: 4.10E-09, Aligned region: 783..827
AAA_22 [PF13401], Evalue: 4.40E-07, Aligned region: 208..295
AAA_22 [PF13401], Evalue: 4.40E-07, Aligned region: 478..529
AAA_22 [PF13401], Evalue: 4.40E-07, Aligned region: 622..717
AAA_22 [PF13401], Evalue: 4.40E-07, Aligned region: 829..856
AAA_17 [PF13207], Evalue: 4.90E-07, Aligned region: 209..268
AAA_17 [PF13207], Evalue: 4.90E-07, Aligned region: 486..524
AAA_17 [PF13207], Evalue: 4.90E-07, Aligned region: 622..658
NACHT [PF05729], Evalue: 7.90E-06, Aligned region: 209..237
NACHT [PF05729], Evalue: 7.90E-06, Aligned region: 623..648
AAA_19 [PF13245], Evalue: 9.70E-06, Aligned region: 206..232
AAA_19 [PF13245], Evalue: 9.70E-06, Aligned region: 621..645
Clp_N [PF02861], Evalue: 2.80E-05, Aligned region: 26..74
Clp_N [PF02861], Evalue: 2.80E-05, Aligned region: 102..122
IstB_IS21 [PF01695], Evalue: 0.0001, Aligned region: 203..228
IstB_IS21 [PF01695], Evalue: 0.0001, Aligned region: 623..641
Sigma54_activat [PF00158], Evalue: 0.00013, Aligned region: 204..226
Sigma54_activat [PF00158], Evalue: 0.00013, Aligned region: 623..740
AAA_23 [PF13476], Evalue: 0.00037, Aligned region: 209..225
AAA_23 [PF13476], Evalue: 0.00037, Aligned region: 441..492
AAA_23 [PF13476], Evalue: 0.00037, Aligned region: 621..654
AAA_18 [PF13238], Evalue: 0.00038, Aligned region: 209..235
AAA_18 [PF13238], Evalue: 0.00038, Aligned region: 469..517
AAA_18 [PF13238], Evalue: 0.00038, Aligned region: 624..655
AAA_29 [PF13555], Evalue: 0.0004, Aligned region: 202..226
AAA_29 [PF13555], Evalue: 0.0004, Aligned region: 621..648
DUF258 [PF03193], Evalue: 0.00048, Aligned region: 175..229
DUF258 [PF03193], Evalue: 0.00048, Aligned region: 622..636
AAA_25 [PF13481], Evalue: 0.00049, Aligned region: 209..233
AAA_25 [PF13481], Evalue: 0.00049, Aligned region: 474..520
AAA_25 [PF13481], Evalue: 0.00049, Aligned region: 620..652
Arch_ATPase [PF01637], Evalue: 0.0028, Aligned region: 189..228
Arch_ATPase [PF01637], Evalue: 0.0028, Aligned region: 261..295
Arch_ATPase [PF01637], Evalue: 0.0028, Aligned region: 622..635
TIP49 [PF06068], Evalue: 0.0036, Aligned region: 209..248
TIP49 [PF06068], Evalue: 0.0036, Aligned region: 257..289
TIP49 [PF06068], Evalue: 0.0036, Aligned region: 623..658
Zeta_toxin [PF06414], Evalue: 0.0068, Aligned region: 207..231
Zeta_toxin [PF06414], Evalue: 0.0068, Aligned region: 451..508
Zeta_toxin [PF06414], Evalue: 0.0068, Aligned region: 622..663
SRP54 [PF00448], Evalue: 0.0097, Aligned region: 209..231
SRP54 [PF00448], Evalue: 0.0097, Aligned region: 622..644
Protein Sequence: 885 a.a.     [Download]
>gi|77461805|ref|YP_351312.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MINVDLQQLIQALDAETRRDLERSAERCVARGGSKILVEDLLLGLLERPNGLLSRALQDADVDAGELSAA
LQSRVEHSASRNPVFAPELVQWLQDALLVANLELGQTSVEDAALILALLRNPMRYAGSRYQPLLAKLNID
RLKEFALSQQPQAAANGKPAAQGESLLERFTHNLTQQARDGKLDPVLCRDGAIRQMVDILARRRKNNPIV
VGEAGVGKTAIVEGLASRIAAGEVPQVLKGVELLSLDMGLLQAGASVKGEFERRLKGVIDEVKASPKPII
LFIDEAHTLIGAGGNAGGSDAANLLKPALARGELRTIAATTWAEYKKYFEKDPALARRFQPVQLHEPTVS
EAVTILRGLAQVYEKSHGIYLRDDAVVSAAELSARYLAGRQLPDKAVDVLDTACARVRISLAAAPESLER
LRGELAEGGRQRQALRRDAEAGLLIDHEALEALEARLDEAEAEMVALETQWTEQKQLAERLLELRQQLAK
AREAAAVEPVVTVEEDAEGTVIETHAAEVDEALSVEALEAQLNETHSALTAAQVKERLVSFEVCPRLVAE
VISAWTGVPLAQLAREHNAKVASFATDLRTRIRGQEQAVHALDRSMRATAAGLNKPDAPVGVFLLVGPSG
VGKTETALALADLLYGGDRFITTINMSEFQEKHTVSRLIGAPPGYVGYGEGGMLTEAVRQKPYSVVLLDE
VEKADPDVLNLFYQIFDKGVANDGEGREIDFRNTLILMTSNLGSDKISDLCEDGARPTAEVLEETIRPVL
SKHFKPALLARMKVVPYYPVGGPVLRELIEIKLGRLGERLNRRQLDFTWCQNLVDHLSERCTQSESGARL
IDHLLDQHVLPLVADRLLDAMATGESLKRVHATLDGEASVTCEFA
 
Nucleotide Sequence: 2658 bp     [Download]
>gi|255961261|ref|NC_007492.2|:c6258259-6255602 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
ATGATCAACGTAGACCTGCAACAACTCATCCAGGCGCTGGACGCCGAAACCCGTCGCGATCTGGAGCGTT
CGGCCGAGCGCTGCGTGGCCCGTGGCGGCAGCAAGATTCTGGTCGAAGACTTGCTGCTCGGCCTGCTGGA
GCGCCCGAACGGTTTGCTCTCGCGGGCACTGCAGGATGCCGACGTTGATGCCGGCGAACTGAGCGCCGCC
CTGCAATCGCGGGTCGAGCACAGCGCTTCGCGCAACCCGGTGTTCGCTCCGGAACTGGTGCAGTGGCTGC
AAGACGCGCTGCTGGTGGCCAACCTTGAACTGGGCCAGACCTCGGTCGAAGACGCGGCGCTTATCCTCGC
GCTGCTGCGCAACCCGATGCGCTACGCCGGCAGCCGCTACCAGCCGTTGCTGGCCAAACTGAACATCGAT
CGCCTGAAGGAATTTGCGCTGTCGCAACAGCCTCAGGCAGCGGCCAACGGTAAGCCGGCCGCCCAGGGCG
AATCGCTGCTGGAGCGCTTCACCCATAACCTGACCCAACAGGCCCGCGACGGCAAACTCGACCCGGTGCT
GTGCCGCGATGGCGCGATCCGCCAGATGGTCGACATCCTCGCCCGTCGCCGCAAGAACAATCCGATCGTG
GTCGGTGAAGCCGGTGTCGGTAAAACCGCCATCGTCGAAGGCCTGGCCTCGCGCATCGCTGCCGGTGAAG
TGCCGCAGGTGCTCAAGGGCGTCGAGCTGCTGTCGCTGGACATGGGCCTGTTGCAGGCCGGCGCCAGCGT
CAAAGGTGAATTCGAACGTCGTCTGAAAGGCGTGATCGACGAGGTCAAAGCCTCGCCGAAGCCGATCATC
CTGTTCATCGACGAGGCCCACACCCTGATCGGCGCGGGCGGTAATGCCGGCGGTTCCGATGCGGCCAACC
TGCTGAAGCCGGCACTGGCGCGCGGCGAACTGCGCACCATCGCCGCGACCACCTGGGCCGAGTACAAGAA
ATACTTCGAAAAAGACCCGGCGCTGGCCCGTCGTTTCCAGCCGGTTCAACTGCACGAACCGACCGTGAGC
GAAGCCGTCACCATCCTGCGTGGCCTGGCTCAGGTCTACGAAAAGAGCCACGGCATCTACCTGCGTGACG
ACGCGGTGGTTTCCGCAGCCGAGCTGTCTGCTCGTTACCTGGCCGGTCGGCAACTGCCGGACAAGGCCGT
CGATGTGCTCGACACCGCGTGCGCCCGCGTTCGCATCAGCCTCGCTGCTGCCCCGGAAAGCCTGGAACGC
CTGCGTGGCGAACTGGCTGAAGGCGGTCGTCAGCGTCAGGCCCTGCGCCGCGATGCCGAAGCCGGTCTGC
TGATCGACCACGAAGCGCTGGAGGCACTGGAAGCGCGCCTGGACGAAGCCGAAGCCGAAATGGTCGCACT
GGAAACCCAGTGGACCGAGCAGAAACAACTGGCCGAGCGCCTGCTGGAACTGCGCCAGCAACTGGCCAAG
GCCCGTGAAGCCGCTGCGGTCGAGCCGGTGGTGACCGTTGAAGAAGACGCCGAAGGCACCGTGATCGAAA
CCCACGCCGCCGAAGTTGACGAAGCTCTTAGCGTCGAAGCGCTGGAAGCACAACTCAACGAAACCCACAG
CGCCCTGACCGCCGCTCAGGTCAAGGAGCGTCTGGTCAGCTTCGAAGTCTGCCCGCGTCTGGTGGCCGAA
GTGATCAGCGCCTGGACCGGCGTGCCGCTGGCGCAACTGGCCCGCGAGCACAACGCCAAGGTCGCCAGCT
TCGCCACCGACCTGCGCACCCGCATCCGGGGTCAGGAACAAGCCGTGCACGCCCTGGATCGCTCGATGCG
CGCCACCGCAGCCGGCCTGAACAAGCCTGACGCACCGGTCGGCGTGTTCCTGCTGGTCGGCCCGAGCGGC
GTCGGCAAGACCGAAACCGCACTGGCACTTGCCGACCTGCTGTACGGCGGCGACCGTTTCATCACCACCA
TCAACATGTCCGAGTTCCAGGAGAAGCACACCGTTTCCCGCCTGATCGGTGCACCGCCAGGTTACGTCGG
TTACGGCGAGGGCGGCATGCTCACCGAGGCCGTGCGCCAGAAGCCGTACTCGGTGGTGCTGCTCGATGAA
GTCGAGAAGGCCGACCCGGACGTGCTCAACCTGTTCTACCAAATCTTCGACAAAGGCGTGGCCAACGACG
GCGAAGGGCGCGAGATCGACTTCCGCAATACGTTGATTCTGATGACCTCGAACCTGGGCAGCGACAAGAT
CAGCGACCTCTGCGAAGACGGCGCGCGTCCGACTGCCGAAGTGCTGGAAGAAACCATTCGCCCGGTGCTC
AGCAAACACTTCAAACCGGCGCTGCTGGCGCGGATGAAAGTGGTGCCGTACTACCCGGTCGGCGGCCCGG
TGCTGCGCGAGCTGATCGAGATCAAGCTCGGTCGCTTGGGCGAGCGTCTGAACCGTCGCCAGCTGGATTT
CACCTGGTGCCAGAACCTCGTCGATCACCTGTCCGAGCGCTGCACCCAAAGCGAAAGCGGTGCACGCCTG
ATCGACCACTTGCTCGACCAGCACGTGCTGCCGCTGGTGGCCGACCGCTTGCTCGACGCCATGGCCACCG
GTGAAAGCCTCAAGCGCGTGCATGCGACGCTCGACGGTGAAGCCAGCGTGACCTGCGAGTTCGCCTGA