SecReT6
Protein ID: 77461806
SecReT6 ID98
T6SS typei1
Gene symbol-
Locus tagPfl01_5585
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T6SS(s) in this replicon]
Location [Strand]6258271..6259197 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ3K4I2
KEGG IDpfo:Pfl01_5585
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.00E-84, Aligned region: 4..293
Protein Sequence: 308 a.a.     [Download]
>gi|77461806|ref|YP_351313.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MLLVIDRLRDAHPYLSEDDLYDQLEFQANPSLGFPRSDVDRVEFFEEHGQMRARLRFNLIGLVGSGSPLP
AFYGEQALGDSEDGNPTRNFLDLFHHRLQRLMLPIWRKYRYRASFQSGAVDPFSSQLFALIGLGGDEIRK
AKELNWKRLLPYLGLLSLRAHSAALIEAVLRYYFKHEDLVIEQCIERRVEILEEQRNRLGFANSVLGEDL
VLGERVRDRSGKFRIHITELDWERFHEFLPIGFGYQPLCALVRFTLRDPLDYDIRLVLRPEEIRELRIGE
KNDCRLGWTSWLGCEKADGVVTLGSKIH
 
Nucleotide Sequence: 927 bp     [Download]
>gi|255961261|ref|NC_007492.2|:c6259197-6258271 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
GTGCTGCTGGTGATCGACCGGCTGCGCGATGCGCACCCGTACCTGAGCGAAGACGATTTGTACGACCAGC
TGGAATTCCAGGCCAACCCGAGCCTCGGATTTCCGCGCAGCGACGTCGATCGCGTGGAGTTTTTCGAAGA
GCACGGGCAGATGCGCGCGCGCCTGCGGTTCAACCTGATCGGTCTGGTCGGTTCCGGTTCGCCGCTGCCG
GCGTTCTACGGCGAGCAAGCCCTGGGCGACAGCGAAGACGGCAACCCGACGCGCAACTTCCTCGACCTGT
TCCACCATCGCCTGCAACGGCTGATGCTGCCGATCTGGCGCAAGTACCGCTATCGCGCGAGTTTCCAGAG
CGGCGCGGTCGACCCGTTCTCGTCGCAGCTGTTCGCCCTGATCGGCCTCGGCGGCGACGAGATCCGCAAG
GCCAAGGAACTGAACTGGAAACGCCTGTTGCCGTACCTCGGCCTGCTCAGTCTGCGGGCGCACTCGGCGG
CGCTGATCGAAGCGGTGCTGCGTTACTACTTCAAGCACGAAGACCTGGTCATCGAGCAGTGCATCGAGCG
CCGCGTGGAAATCCTCGAAGAACAACGCAACCGCCTCGGCTTCGCCAACAGTGTGCTGGGTGAAGACCTG
GTGCTGGGCGAACGCGTGCGCGATCGCAGCGGCAAGTTCCGCATTCACATCACCGAACTCGACTGGGAGC
GATTCCACGAATTCCTGCCCATCGGTTTCGGTTACCAGCCGCTTTGCGCGCTGGTGCGGTTCACCTTGCG
TGACCCGCTCGATTACGACATTCGCCTGGTGCTGCGCCCGGAAGAAATCCGCGAACTGCGCATTGGCGAG
AAGAACGACTGTCGCCTGGGTTGGACCAGTTGGCTGGGCTGCGAGAAAGCAGACGGCGTGGTGACCCTGG
GCAGCAAAATTCATTAA