SecReT6
Protein ID: 77461807
SecReT6 ID98
T6SS typei1
Gene symbol-
Locus tagPfl01_5586
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T6SS(s) in this replicon]
Location [Strand]6259242..6261029 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ3K4I1
KEGG IDpfo:Pfl01_5586
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.50E-185, Aligned region: 3..595
Protein Sequence: 595 a.a.     [Download]
>gi|77461807|ref|YP_351314.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MSFNHYYQSELTALRQLGRRFAERSPALAPFLGQAGRDPDVERLLEGFAFLTGRLRQKLDDELPELSHSL
MQLLWPNYMRPLPAFSILQFDPLKRSGPALKVERDTPIESVPIEDVRCRFRTCYPTEVMALDLAALNYSV
KGDGSLLSLRLEMSADGHLGELELSKLRLHFAGERYISQMLYLSLLRNLDGIELIPLDGAGKPIDGVSGK
PMAFKIPGDRVKPVGFAEEEALIPYPLNTFRGYRYLQEYFAFQDKFLFVDVHGLDILKALPEDTLKQMRG
LELRFDIRKSGIMRMRPTLDNVKLFCTPIVNLFKHDALPIRLDGKQDEYLLLPAEYDLENCGVFSVETVT
GWKPGGLGYQEYVPFESFEHDPSFDVPNSRPHYSIRQRSSLLHDGLDTYLSFGIRHTEAHETLSIELVCT
NQNLPRKLKLGQICMACEETPEFLSFRNITPATSSFAPPLNRDFLWKLISNMSLNYLSLADVNALKVILE
TYDLPRYYDQHAEKVSKRLLGGLKHIKHHHVDRLHRGLPVRGLRTELTIDPEGYIGEGDLFVFASVLNEF
FALYASLNSFHELRVKSTQGEVYQWTPRMGLQPLL
 
Nucleotide Sequence: 1788 bp     [Download]
>gi|255961261|ref|NC_007492.2|:c6261029-6259242 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
GTGTCCTTTAACCACTACTACCAAAGCGAACTCACCGCACTGCGCCAGCTGGGCCGCCGTTTCGCCGAGC
GTAGTCCGGCGTTGGCGCCGTTCCTGGGGCAGGCCGGGCGGGATCCGGATGTGGAGCGGTTGCTGGAAGG
CTTTGCGTTTCTGACCGGGCGGCTGCGCCAGAAGCTCGATGACGAGTTGCCGGAGCTCAGCCATTCCCTG
ATGCAGTTGTTGTGGCCGAACTACATGCGCCCGCTGCCTGCGTTCAGCATTCTGCAGTTCGATCCGCTCA
AGCGTTCCGGGCCGGCGCTGAAGGTCGAGCGTGACACGCCGATCGAGAGCGTGCCGATCGAAGACGTGCG
TTGCCGCTTTCGCACCTGCTACCCGACCGAAGTCATGGCGCTGGATCTGGCCGCGCTGAACTACTCGGTG
AAGGGCGACGGTTCGCTGCTCAGCCTGCGCCTGGAGATGAGTGCCGACGGCCACCTCGGCGAGCTTGAGC
TGAGCAAGCTGCGCCTGCACTTTGCCGGCGAGCGCTACATCAGCCAGATGCTCTACCTGAGCCTGCTGCG
CAACCTCGACGGCATCGAACTTATCCCGCTCGACGGCGCCGGCAAGCCGATCGATGGCGTGAGCGGCAAG
CCGATGGCGTTCAAGATTCCGGGCGACCGGGTCAAACCGGTGGGCTTTGCCGAAGAAGAAGCGTTGATCC
CGTATCCGCTGAACACTTTCCGCGGCTATCGCTATCTGCAGGAATACTTCGCCTTCCAGGACAAGTTCCT
GTTCGTCGATGTCCACGGCCTCGACATCCTCAAGGCGCTGCCGGAAGACACCCTCAAGCAGATGCGCGGC
CTGGAATTGCGCTTCGACATCCGCAAGAGCGGCATCATGCGCATGCGTCCGACCCTTGATAACGTGAAGC
TGTTCTGCACGCCGATCGTCAACCTGTTCAAGCACGACGCACTGCCGATCCGCCTCGACGGCAAACAGGA
TGAATACCTGCTGCTGCCGGCCGAATACGATCTGGAAAACTGCGGCGTGTTCTCGGTTGAAACCGTGACC
GGCTGGAAACCCGGCGGCCTCGGTTATCAGGAGTACGTGCCGTTCGAATCCTTCGAGCACGACCCAAGTT
TCGACGTGCCCAACAGCCGTCCGCATTACAGCATCCGTCAGCGTTCGTCGCTGCTGCACGACGGCCTCGA
CACCTACCTGAGCTTCGGCATCCGCCACACCGAAGCCCATGAAACCCTGTCGATCGAGCTGGTCTGCACC
AACCAGAACCTGCCGCGCAAACTCAAGCTCGGGCAGATCTGCATGGCCTGCGAAGAGACCCCGGAGTTCC
TGAGTTTCCGCAACATCACCCCGGCCACTTCGAGTTTTGCGCCGCCGCTGAACCGTGACTTCCTGTGGAA
GCTGATCAGCAACATGTCGCTTAACTATCTGTCGCTGGCCGACGTCAATGCATTGAAGGTGATTCTCGAA
ACCTACGACCTGCCGCGCTACTACGACCAGCACGCGGAGAAGGTCAGCAAACGCCTGCTCGGCGGTCTCA
AGCACATCAAGCATCACCACGTGGACCGCTTGCACCGTGGTTTGCCGGTGCGCGGTCTGCGCACCGAACT
GACCATCGACCCGGAAGGGTATATCGGCGAAGGCGACCTGTTCGTCTTCGCCTCGGTTCTCAACGAGTTT
TTCGCGCTTTACGCCAGTCTCAATTCATTCCATGAGCTGCGGGTAAAAAGCACACAGGGAGAGGTGTACC
AATGGACACCACGTATGGGCCTGCAGCCCCTGCTTTAA