SecReT6
Protein ID: 77461813
SecReT6 ID98
T6SS typei1
Gene symbol-
Locus tagPfl01_5592
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T6SS(s) in this replicon]
Location [Strand]6263127..6264536 [-]
Producthypothetical protein
NotePAAR
UniProt IDQ3K4H5
KEGG IDpfo:Pfl01_5592
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 4.20E-20, Aligned region: 2..53
PAAR_motif [PF05488], Evalue: 4.20E-20, Aligned region: 58..83
DUF4150 [PF13665], Evalue: 0.0041, Aligned region: 2..14
DUF4150 [PF13665], Evalue: 0.0041, Aligned region: 25..47
DUF4150 [PF13665], Evalue: 0.0041, Aligned region: 57..82
Peptidase_MA_2 [PF13485], Evalue: 0.0043, Aligned region: 310..367
Peptidase_MA_2 [PF13485], Evalue: 0.0043, Aligned region: 372..401
FlgD_ig [PF13860], Evalue: 0.0055, Aligned region: 155..198
Protein Sequence: 469 a.a.     [Download]
>gi|77461813|ref|YP_351320.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MSGKPAARVSDPTACPLPGHGTNPIAAGSGDVFFDGLPAARQGDASACGSALVGDLATTVLINGKPAATV
GSVGAHGNKVTAGSGTVIIGNSHTPAPFSGLAALAVAAALEYRLGLKSGGNSVLTPLEIPDFDELKSGTS
KNRELVDFVVENRMDAADSVKLEVLDGEKPVYTEANTAPFLPPGKHPWQWDGYDTAGILDTKILKSPNLK
VRLTATGAGKQQVTEVKLTCSAEEVKWVDARIDRNAKTVEVTLRPSFSEGGSTGSTPGLVPTPLSTLLGW
AKEGIELYWSRNGSRGGGIAEGIATSKGVYKVTVKAEVNVEPKAGNFPLIDSLSADFGRSTSLAIARKVY
HNAGYAFDQLVKRQGLTAADAANYAQEEFKETSAHEFGHLILNEYGGGLIPNYSWTHKETSTLMQNPKAN
HPTPSTGEVDVMHYFSSYTQTSTNLQKRMAASEQDVKSLLWLARVEFND
 
Nucleotide Sequence: 1410 bp     [Download]
>gi|255961261|ref|NC_007492.2|:c6264536-6263127 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
ATGTCTGGCAAACCAGCAGCACGCGTATCCGACCCCACCGCTTGCCCGCTCCCCGGCCACGGCACCAACC
CGATCGCCGCCGGTTCCGGCGACGTGTTCTTCGACGGCCTGCCAGCGGCCCGCCAGGGCGATGCCTCGGC
GTGTGGCAGTGCATTGGTCGGCGACCTTGCGACCACGGTTCTGATCAATGGCAAGCCGGCCGCCACCGTA
GGTTCAGTCGGGGCCCATGGCAACAAGGTCACTGCCGGCTCCGGGACGGTAATCATCGGGAATTCGCATA
CGCCTGCACCGTTTTCGGGGCTTGCTGCCCTGGCGGTCGCCGCTGCTCTGGAATACCGACTGGGTCTGAA
GTCGGGTGGCAACTCGGTTTTGACCCCGCTGGAAATACCGGACTTCGATGAACTGAAGTCCGGAACATCG
AAAAACCGCGAACTGGTCGACTTCGTCGTCGAGAACCGGATGGACGCGGCAGACAGTGTGAAGCTGGAAG
TGCTGGACGGCGAAAAGCCGGTCTACACCGAAGCCAATACCGCCCCGTTCTTGCCCCCTGGCAAGCACCC
GTGGCAATGGGATGGGTACGACACTGCCGGCATCCTCGACACCAAAATCCTGAAAAGCCCGAACCTCAAA
GTTCGTCTGACCGCGACCGGAGCGGGCAAGCAGCAAGTCACCGAAGTGAAGCTCACTTGTTCGGCTGAAG
AGGTGAAGTGGGTCGATGCGCGTATTGATCGCAATGCCAAGACCGTGGAAGTGACGCTGCGCCCGAGCTT
CTCGGAGGGTGGCAGCACTGGTTCCACGCCTGGCCTGGTGCCTACGCCGCTCAGCACTTTGCTGGGTTGG
GCCAAGGAGGGCATCGAATTGTATTGGTCACGCAATGGTTCGCGCGGTGGTGGCATTGCCGAAGGAATCG
CGACCAGCAAAGGGGTCTACAAAGTCACGGTCAAGGCCGAGGTCAACGTCGAGCCAAAGGCCGGGAACTT
CCCGTTGATTGACTCGTTGTCAGCGGACTTCGGTCGTTCGACCAGCCTGGCAATTGCCCGTAAGGTTTAC
CACAACGCTGGCTACGCCTTTGACCAACTCGTCAAGCGTCAAGGCCTTACGGCTGCGGATGCTGCCAACT
ATGCGCAGGAAGAGTTCAAAGAGACCTCGGCCCATGAATTCGGGCATCTGATTCTCAACGAATACGGTGG
TGGGCTGATCCCGAACTACTCGTGGACGCACAAAGAAACCTCAACGTTGATGCAAAACCCCAAGGCAAAC
CACCCGACACCGAGCACGGGTGAGGTGGATGTCATGCATTACTTCAGCAGCTACACCCAGACGTCCACCA
ACCTGCAGAAGCGCATGGCCGCTTCTGAACAGGACGTGAAAAGCCTGCTTTGGTTGGCCAGGGTTGAATT
CAATGACTAG