SecReT6
Protein ID: 77461814
SecReT6 ID98
T6SS typei1
Gene symbol-
Locus tagPfl01_5593
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T6SS(s) in this replicon]
Location [Strand]6264548..6264955 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ3K4H4
KEGG IDpfo:Pfl01_5593
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.50E-18, Aligned region: 25..114
Protein Sequence: 135 a.a.     [Download]
>gi|77461814|ref|YP_351321.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MDGYGSLFERLNGDAELRKGRSLEASAMASVAAHLAKMLSTRAGSVQTLSDYGLPDLNDMRLSLHDSLSQ
ARLAIESFIEAYEPRLSNVRVISLPRDHDQLRLAFSIEGLLEVEGFKRQVSFAARLDGSGQVKVN
 
Nucleotide Sequence: 408 bp     [Download]
>gi|255961261|ref|NC_007492.2|:c6264955-6264548 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
ATGGACGGATACGGCAGCCTCTTCGAACGCCTCAACGGCGACGCGGAACTACGCAAGGGCAGGAGCCTCG
AGGCTTCGGCCATGGCGTCGGTGGCTGCCCATCTGGCCAAAATGCTCAGCACCCGGGCCGGCAGCGTGCA
AACGCTGTCCGACTACGGGTTGCCCGATCTCAATGACATGCGCCTGAGCCTGCACGACTCCCTGAGTCAG
GCCCGCCTGGCCATCGAAAGCTTCATCGAAGCCTACGAACCGCGCCTGAGCAACGTGCGTGTCATTTCCC
TGCCGCGTGACCACGACCAGCTTCGCCTGGCCTTCAGCATCGAAGGCCTGCTGGAAGTCGAGGGTTTCAA
GCGTCAGGTCAGTTTCGCTGCGCGCCTGGATGGCAGCGGTCAAGTGAAGGTCAACTAA