SecReT6
Protein ID: 77461815
SecReT6 ID98
T6SS typei1
Gene symbol-
Locus tagPfl01_5594
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T6SS(s) in this replicon]
Location [Strand]6264965..6266440 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ3K4H3
KEGG IDpfo:Pfl01_5594
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.20E-192, Aligned region: 64..489
Protein Sequence: 491 a.a.     [Download]
>gi|77461815|ref|YP_351322.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MSTSAAQQNAAENGEYSILDSIIAETRLTPDDEAYDIAKRGVSAFIEELLKPQNNGEPVKKAMVDRMIAE
IDAKLSRQMDEILHHPDFQALESSWRGLQLLVDRTNFRENIKIEILNVSKEDLLDDFEDSPEVMQSGLYK
HIYTAEYGQFGGQPVGAIIANYYMSPSSPDVKLMQYVSSVACMSHAPFIAAAGPKFFGLESFTGLPDLKD
LKDHFEGPQFAKWQSFRTSEDSRYVGLTVPRFLLRNPYDPEENPVKSFVYKENVANSHEHYLWGNTAYAF
GTKLTDSFAKFRWCPNIIGPQSGGAVEDLPLHHFESMGEIETKIPTEVLVSDRREYELAEEGFISLTMRK
GSDNAAFFSASSVQKPKFFGISAEGKAAELNYKLGTQLPYMMIVNRLAHYLKVLQREQLGSWKERTDLEL
ELNKWIRQYVADQENPSAEVRGRRPLRAAQVIVSDVEGEPGWYRVSLNVRPHFKYMGADFTLSLVGKLDK
E
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|255961261|ref|NC_007492.2|:c6266440-6264965 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
ATGAGCACTAGCGCAGCACAACAGAACGCCGCAGAAAACGGCGAGTACAGCATCCTCGACAGCATCATCG
CCGAAACCCGCCTGACGCCGGACGACGAAGCCTACGACATCGCCAAACGCGGTGTGTCGGCGTTCATCGA
AGAGCTGCTCAAGCCGCAGAACAACGGTGAGCCGGTCAAGAAAGCCATGGTTGACCGCATGATCGCCGAG
ATCGATGCCAAGCTCAGCCGTCAGATGGACGAAATCCTGCACCACCCGGACTTCCAGGCCCTGGAATCGT
CGTGGCGTGGCCTGCAACTGCTGGTCGACCGCACCAACTTCCGCGAAAACATCAAGATCGAAATCCTCAA
CGTCTCCAAAGAAGACCTGCTGGACGATTTCGAAGACTCGCCGGAAGTGATGCAGTCGGGCCTGTACAAG
CACATCTACACCGCTGAATACGGCCAGTTCGGTGGTCAGCCGGTTGGCGCGATCATTGCCAACTACTACA
TGTCCCCAAGCTCGCCGGACGTGAAGCTGATGCAGTACGTGTCCAGCGTAGCCTGCATGTCCCACGCACC
GTTCATCGCCGCCGCCGGCCCGAAATTCTTCGGCCTGGAAAGCTTCACCGGCCTGCCGGACCTGAAGGAT
CTGAAAGATCACTTCGAAGGCCCGCAATTCGCCAAATGGCAGAGCTTCCGTACCTCGGAAGACTCCCGCT
ACGTCGGCCTGACCGTGCCGCGTTTCCTGCTGCGTAACCCGTACGACCCGGAAGAAAACCCGGTCAAATC
GTTCGTGTACAAGGAAAACGTTGCCAACAGCCACGAGCACTACCTGTGGGGCAACACCGCTTACGCGTTC
GGCACCAAGCTGACCGACAGCTTCGCCAAGTTCCGCTGGTGCCCGAACATCATCGGCCCACAGAGCGGCG
GCGCGGTTGAAGACCTGCCTCTGCACCACTTCGAAAGCATGGGCGAAATCGAAACCAAGATTCCTACCGA
AGTTCTGGTTTCCGACCGTCGTGAATACGAACTGGCCGAGGAAGGCTTCATCTCCCTGACCATGCGCAAA
GGCTCCGACAACGCGGCGTTCTTCTCCGCCAGCTCGGTGCAGAAGCCGAAGTTCTTCGGCATCAGCGCAG
AAGGCAAGGCGGCAGAGCTGAACTACAAGCTCGGCACCCAACTGCCGTACATGATGATCGTCAACCGCCT
GGCTCACTACCTGAAAGTGCTGCAGCGCGAGCAACTCGGTTCGTGGAAAGAGCGTACCGACCTCGAGCTG
GAACTGAACAAGTGGATCCGCCAGTACGTGGCCGACCAGGAAAACCCGAGCGCCGAAGTACGTGGCCGCC
GTCCGCTGCGCGCTGCGCAAGTGATCGTCAGCGACGTTGAAGGCGAGCCGGGCTGGTACCGCGTCAGCCT
GAACGTGCGCCCGCACTTCAAGTACATGGGTGCCGATTTCACCCTGTCGCTGGTTGGCAAGCTGGACAAA
GAGTAA