SecReT6
Protein ID: 77461816
SecReT6 ID98
T6SS typei1
Gene symbol-
Locus tagPfl01_5595
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T6SS(s) in this replicon]
Location [Strand]6266469..6266972 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ3K4H2
KEGG IDpfo:Pfl01_5595
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.20E-53, Aligned region: 5..159
Protein Sequence: 167 a.a.     [Download]
>gi|77461816|ref|YP_351323.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MAKEGSVAPKERINVTFKPATGGAQEEIELPLKLLAIGDYTHRKDDRKIEDRKPISIDKMTFDEVLAKQE
LGLTLSVPNRLQEDGEADELAVQLRVNSMKDFNPASLVEQVPELKKLMELRDALVALKGPLGNAPAFRKA
IEGVLADDESRGRVLGELGLNAAAPDA
 
Nucleotide Sequence: 504 bp     [Download]
>gi|255961261|ref|NC_007492.2|:c6266972-6266469 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
ATGGCCAAAGAAGGCTCGGTAGCCCCCAAGGAACGCATCAACGTCACCTTCAAACCCGCCACCGGCGGTG
CTCAGGAAGAGATTGAACTGCCGCTGAAGCTGCTGGCAATCGGTGACTACACCCACCGCAAGGACGATCG
CAAGATCGAGGATCGCAAGCCGATCAGCATCGACAAGATGACCTTCGACGAAGTGCTGGCCAAGCAAGAG
CTGGGTCTGACGCTGAGCGTGCCGAACCGTCTGCAGGAAGATGGCGAGGCCGACGAGCTGGCTGTGCAAC
TGCGCGTCAACTCCATGAAGGACTTCAACCCGGCCAGCCTGGTCGAGCAAGTGCCTGAGCTGAAAAAACT
GATGGAACTGCGCGACGCGCTGGTGGCCCTCAAAGGCCCGCTGGGTAACGCACCTGCGTTCCGTAAAGCC
ATCGAAGGCGTGCTCGCCGACGACGAATCCCGCGGTCGCGTACTCGGTGAGCTGGGCCTGAACGCCGCAG
CTCCGGACGCTTGA