SecReT6
Protein ID: 77461817
SecReT6 ID98
T6SS typei1
Gene symbol-
Locus tagPfl01_5596
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T6SS(s) in this replicon]
Location [Strand]6267005..6268567 [-]
ProductImpA-like protein
NoteTssA
UniProt IDQ3K4H1
KEGG IDpfo:Pfl01_5596
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.20E-21, Aligned region: 55..115
Protein Sequence: 520 a.a.     [Download]
>gi|77461817|ref|YP_351324.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MSYSSKLSAHYLELAKVSVSKENFAGEDVRFSSEFEALESELAKASSMHESGQIDWLKIRENSENLLRTQ
SKDLRVGAWLTWSLYQRESFPGLLAGLGLLHHLSENNWAEVHPLKPRTRAAAIGWLVPRLEQVITENIAI
KEQLPMFRQLSEHLSGLDAACTEHLGDDAPLLLPLSRRLKTMIQRAADNQPAPGVVGAAVAQVKQAASQL
LAPGAPIDNEKEAHKALRAQQESARPLCAWWLKQKATDLRALRLNRTLLWMTIDAVPERNAEQITVLRGL
PVDKLKQYQDRFDQGKYADLLVELEASLAKAPFWFDGQRMVWECLQNLNAELAMREVEIHFALLIQRLPG
IIELRFHDGAPFADPSTRAWIAANVMPHLQSASAPRKVETENAETQPAWEKALEEVQPILRKEGLKPAVQ
ILKQGLQSAHGGRERFFWQFALARLCFLAKKYELAKNQLETLDQTLQDSGLHAWEPDLALEVLHLLHSCC
ELLPQNHAVRERKEEIYRRLCHLDLEVVLE
 
Nucleotide Sequence: 1563 bp     [Download]
>gi|255961261|ref|NC_007492.2|:c6268567-6267005 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
ATGTCCTACTCAAGCAAACTTTCCGCCCATTACCTCGAACTCGCTAAAGTCTCTGTTTCCAAAGAGAATT
TTGCGGGCGAAGACGTTCGCTTTTCGAGCGAATTCGAGGCGCTGGAAAGCGAGCTGGCCAAAGCCTCGTC
GATGCACGAAAGCGGGCAGATCGACTGGCTGAAAATTCGCGAAAACAGCGAAAACCTCCTGCGTACCCAA
TCCAAGGATTTGCGTGTCGGCGCCTGGCTGACGTGGTCGCTGTACCAGCGTGAATCCTTCCCCGGCCTGC
TGGCCGGCCTCGGTCTGCTGCACCACTTGTCGGAAAACAATTGGGCCGAAGTTCACCCGCTCAAACCCCG
CACCCGGGCCGCCGCCATCGGCTGGCTGGTGCCGCGTCTTGAGCAGGTCATCACCGAGAACATCGCGATC
AAGGAACAGCTGCCGATGTTCCGGCAACTGTCCGAGCATCTGTCCGGTCTCGACGCCGCCTGCACCGAGC
ATCTGGGCGATGATGCGCCACTGCTGCTGCCGCTTTCCCGCCGTCTGAAAACCATGATCCAGCGCGCCGC
CGACAACCAGCCGGCACCCGGTGTTGTGGGCGCGGCGGTGGCGCAGGTCAAGCAGGCCGCCAGCCAGTTG
CTGGCGCCGGGCGCGCCGATCGACAACGAGAAAGAAGCCCACAAGGCCCTGCGTGCACAGCAGGAAAGCG
CCCGCCCGTTGTGCGCCTGGTGGCTCAAGCAGAAAGCTACCGACCTGCGCGCCCTGCGCCTCAACCGCAC
CTTGCTGTGGATGACGATCGACGCGGTGCCCGAGCGCAACGCCGAGCAGATCACCGTGCTGCGCGGGTTG
CCGGTCGACAAGCTCAAGCAGTATCAGGACCGTTTCGATCAGGGCAAATACGCCGACCTGCTGGTGGAAC
TGGAGGCGAGCCTGGCGAAGGCGCCGTTCTGGTTCGATGGCCAGAGGATGGTCTGGGAATGTCTCCAGAA
CCTCAACGCCGAGCTGGCCATGCGCGAAGTGGAAATCCACTTCGCGCTTTTGATTCAACGCCTGCCCGGC
ATCATCGAGCTGCGTTTCCATGACGGCGCGCCGTTCGCCGATCCGTCCACCCGGGCGTGGATCGCCGCCA
ACGTCATGCCGCACCTGCAAAGCGCCAGCGCGCCGCGCAAGGTCGAAACCGAAAACGCCGAAACCCAGCC
GGCCTGGGAAAAGGCCCTCGAAGAAGTCCAGCCGATCCTGCGCAAGGAAGGCCTCAAGCCCGCAGTGCAG
ATCCTCAAGCAGGGGCTGCAATCGGCGCACGGCGGGCGCGAACGCTTCTTCTGGCAGTTCGCCCTCGCGC
GGCTGTGTTTCCTGGCCAAGAAATACGAACTCGCCAAGAACCAGCTCGAAACCCTCGATCAGACATTACA
GGACTCAGGCCTGCACGCCTGGGAGCCCGATCTTGCATTGGAAGTGCTGCACCTGCTGCACAGTTGCTGC
GAGTTGTTACCGCAGAACCATGCCGTACGTGAACGCAAGGAAGAGATTTATCGCAGGCTGTGCCACCTCG
ATCTCGAAGTGGTACTCGAATAG