SecReT6
Protein ID: 77461818
SecReT6 ID98
T6SS typei1
Gene symbol-
Locus tagPfl01_5597
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T6SS(s) in this replicon]
Location [Strand]6269283..6272639 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ3K4H0
KEGG IDpfo:Pfl01_5597
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.00E-64, Aligned region: 29..322
DUF2235 [PF09994], Evalue: 7.70E-28, Aligned region: 644..932
Phage_base_V [PF04717], Evalue: 3.30E-21, Aligned region: 370..461
Protein Sequence: 1118 a.a.     [Download]
>gi|77461818|ref|YP_351325.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MPGAVSSAHFTLQISAVRNDFKVLAFEGTETVSTLYAIHVELVSEDPDFDMEGLLGQTAFLQFGLNDEGI
HGCIDDVLAGESDKRLTRYRLTLVPSLHYLQFSHDQRIYQSQTVPQIITQTLKRHGILVDAFTFHVQPLV
AREYCTQYGESDFEFIQRLCAEEGIAWHHQHSAQGHLLVFTDDAVFLPTLRPTPFRRENGMVPEYPVVSS
FSLRAATRTSRVTRRGYDLKRPTLLLESRFSAGFTPTLEDYRYPLLLDNEKRGKHLARQALERHRADYEI
AEGQSNQTTLRCGHLLELTEHPRQNYNGLWLLLGVTHTGRQPQVLEESASSETQSADGFTQGYRNTFCAI
PAEVVFRPPLPARRPPLVSQTARVTGPKGEEIYCDEFGRVKVEFHWDRAELNSERSSCWVRVSSSWAGNG
FGVVTLPRIGMEVVVTFVEGDPDKPLITGCVINKVTPAPYKLPEHKTRTVLRSRSSPDTGGYSELMIEDR
AGLELVYLRAQRDMERQVLHDSRLAVGRDRWESIQGSSQTTAGKIITVEAGQQVQIKAGASVVLDAGASI
TLKAGGHHIVIDRGGIFSSTEIVAGGKTSASGAADHPEAAMAGALAAGLTASSTQDPEDAELEEEEEEVE
LEDELPAGITLRIGVFFDGTGNNKANSETVAACYAPDANLAEAAEEIQKHCAAYGYDGNGNSPDNSYGND
VSNIVRLHELYTDHAFDVLPENTKQASLRVYIEGIGTTADVDDSLYAQATGRGETGVLARVEQSPEKIME
QIRSLIDSNPNTLIERIEFDIFGFSRGAAAARHFANEVLKGKRSILAKALPAGSPFLVSSFDWVSQSSIS
INFIGLFDTVAAIANPWLLDFTGANSRNPGLNLKLPEGCANKVVHLVARDEHRENFALNSLGEIDLVLPG
AHSDLGGGYLPRAREKLLLSSPITSTISQSKEATRSAAYVSAEKEAFAWYTKGVIEDDAPGNQLRVALWE
APVIQRLERGRSTPEPQKRVYAAAMIERPVHGELSLVYLRIMRELAVRAGVPLKLIPDRSALNLPAELVP
IHKKLQAYALGESSVEGLTIKERALLRSRYIHLSAHWNAAKDFNNSDWSVVFINRPTKNKQRVVHPHE
 
Nucleotide Sequence: 3357 bp     [Download]
>gi|255961261|ref|NC_007492.2|:6269283-6272639 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
ATGCCTGGAGCTGTCAGTTCTGCGCACTTCACTCTGCAGATTTCTGCTGTTCGCAATGACTTCAAGGTGC
TGGCCTTCGAGGGCACCGAGACCGTCAGCACCCTTTATGCCATTCACGTCGAACTGGTCAGTGAAGATCC
CGACTTCGATATGGAAGGCCTGCTCGGTCAGACTGCCTTCCTGCAGTTCGGCCTGAACGATGAAGGCATT
CATGGATGCATCGACGATGTGTTGGCGGGTGAATCCGACAAACGCCTGACCCGCTATCGCCTGACACTGG
TGCCGAGCCTCCACTATTTGCAGTTCAGTCACGATCAACGGATTTACCAGAGTCAGACCGTCCCGCAGAT
CATCACGCAAACGCTCAAGCGACACGGCATCCTCGTCGATGCGTTCACTTTTCATGTCCAGCCCCTCGTG
GCACGGGAGTACTGCACCCAATACGGCGAAAGCGATTTCGAGTTCATCCAGCGCCTGTGTGCCGAGGAGG
GAATCGCCTGGCATCATCAGCACTCGGCGCAAGGCCATTTGCTGGTGTTCACCGATGATGCGGTTTTCCT
CCCGACATTGCGTCCCACGCCCTTCCGGCGGGAAAACGGGATGGTCCCGGAATATCCGGTGGTCAGCAGC
TTTTCCTTGCGCGCCGCCACTCGGACAAGCCGGGTCACCCGGCGTGGTTACGACCTGAAGCGACCGACGC
TTTTACTCGAAAGCCGCTTCAGCGCCGGATTCACACCGACGCTTGAGGACTACCGATACCCGCTGCTGCT
GGACAACGAAAAGCGCGGCAAGCATCTGGCCCGTCAGGCCCTGGAACGCCATCGCGCCGATTATGAAATA
GCCGAGGGTCAAAGCAACCAGACGACCCTGCGCTGTGGCCATCTGCTTGAACTGACCGAACACCCTCGTC
AGAACTACAACGGTCTGTGGCTGCTGCTCGGTGTCACCCACACCGGACGGCAGCCGCAAGTTCTGGAGGA
GTCGGCCAGCAGCGAAACTCAATCGGCGGACGGCTTTACCCAAGGCTATCGCAACACCTTCTGCGCCATT
CCTGCCGAAGTAGTGTTCCGCCCGCCACTGCCCGCACGCCGGCCCCCGCTGGTCAGCCAGACCGCCAGGG
TGACAGGCCCCAAAGGCGAAGAGATCTACTGCGATGAGTTCGGTCGGGTAAAAGTCGAATTCCACTGGGA
CCGAGCCGAATTAAACAGTGAGCGCAGCAGTTGCTGGGTGCGGGTCTCGTCGAGCTGGGCCGGGAACGGT
TTCGGTGTCGTCACCCTCCCCCGCATCGGGATGGAAGTGGTGGTGACCTTCGTGGAAGGTGATCCCGACA
AGCCGCTGATTACCGGCTGCGTGATCAACAAGGTCACCCCTGCACCCTACAAACTTCCCGAGCACAAGAC
CCGAACCGTGTTGCGCAGTCGCAGCTCGCCTGACACCGGCGGCTACAGCGAATTGATGATTGAAGACCGC
GCCGGACTGGAACTGGTCTACCTGCGTGCCCAGCGCGACATGGAGCGGCAGGTTCTCCATGACAGCCGGC
TGGCGGTCGGGCGCGATCGATGGGAAAGCATTCAGGGCAGCAGCCAGACGACGGCCGGGAAAATCATTAC
CGTCGAGGCGGGCCAGCAGGTGCAGATCAAGGCCGGTGCCAGCGTGGTGCTGGATGCAGGCGCCAGCATC
ACGCTGAAGGCGGGCGGTCACCATATCGTGATCGACAGGGGCGGGATCTTCAGCAGTACCGAGATCGTGG
CGGGAGGAAAGACGTCCGCCAGCGGAGCCGCTGATCATCCAGAAGCCGCAATGGCGGGAGCCTTGGCGGC
CGGACTGACGGCCTCATCCACTCAAGACCCGGAAGACGCCGAACTCGAAGAAGAGGAGGAAGAGGTCGAA
CTGGAAGACGAGTTACCTGCTGGCATCACCTTGCGGATCGGCGTGTTTTTCGATGGGACGGGGAACAACA
AGGCCAACAGCGAAACGGTCGCGGCTTGCTATGCGCCAGATGCCAATCTGGCGGAGGCAGCCGAAGAGAT
TCAGAAGCACTGCGCCGCTTATGGCTATGACGGAAATGGCAACTCGCCGGATAACAGCTACGGCAATGAT
GTAAGCAATATCGTGCGGTTGCATGAGCTGTATACAGACCATGCCTTTGACGTATTACCAGAGAACACGA
AACAGGCTTCTTTGCGCGTATACATCGAAGGCATCGGTACAACCGCTGACGTAGACGACTCACTTTACGC
ACAGGCAACCGGCCGAGGCGAAACGGGTGTTCTGGCTCGTGTGGAGCAGAGCCCTGAAAAAATCATGGAG
CAAATTCGGTCACTGATTGATAGCAACCCCAACACGCTAATAGAAAGAATCGAATTCGATATTTTCGGTT
TCAGTCGAGGCGCCGCCGCTGCACGGCACTTCGCAAACGAGGTGCTAAAAGGCAAGCGCAGCATTCTCGC
AAAGGCGTTGCCAGCAGGCTCTCCGTTCTTGGTCAGTAGCTTTGACTGGGTTTCACAATCCAGTATCAGC
ATCAATTTCATTGGTCTGTTTGATACCGTCGCGGCAATCGCCAATCCATGGTTGCTCGACTTCACTGGCG
CCAACAGCAGAAATCCGGGACTGAACTTGAAGCTGCCGGAGGGTTGCGCCAACAAAGTGGTGCACCTGGT
GGCGCGTGATGAACATCGCGAGAACTTTGCCCTTAATAGCCTGGGTGAGATTGATCTGGTATTACCCGGC
GCCCACTCGGATCTGGGAGGTGGCTATCTGCCCAGGGCCAGGGAGAAACTTCTGTTGAGCAGTCCGATCA
CCAGCACCATCAGCCAAAGCAAGGAAGCGACCCGTAGCGCAGCCTATGTCTCTGCCGAAAAGGAGGCGTT
TGCCTGGTATACGAAAGGCGTCATCGAAGATGACGCTCCAGGCAATCAACTGCGGGTTGCACTCTGGGAA
GCCCCTGTCATTCAACGATTGGAAAGGGGCAGATCCACACCGGAGCCCCAGAAGCGGGTTTATGCTGCGG
CCATGATTGAACGCCCGGTACACGGTGAGTTGTCGCTGGTGTATTTACGCATCATGCGTGAGCTGGCGGT
AAGAGCCGGGGTGCCGCTCAAGCTGATTCCCGACAGGTCAGCGCTAAATTTGCCCGCAGAGTTAGTACCC
ATTCACAAAAAACTTCAGGCTTACGCCTTGGGTGAGTCATCTGTTGAAGGGCTGACTATCAAAGAACGGG
CTTTGTTACGCAGTCGCTATATCCACCTATCTGCGCACTGGAACGCAGCCAAAGATTTCAACAACAGCGA
CTGGAGCGTTGTTTTTATCAACCGCCCAACAAAGAACAAACAACGAGTGGTGCACCCCCATGAATAA