SecReT6
Protein ID: 77465475
SecReT6 ID99
T6SS typei3
Gene symbol-
Locus tagRSP_3474
StrainRhodobacter sphaeroides 2.4.1
Repliconchromosome II [GenBank: NC_007494] [Browse all T6SS(s) in this replicon]
Location [Strand]541487..544156 [-]
Producthypothetical protein
NoteTssH
UniProt IDQ3IWK7
KEGG IDrsp:RSP_3474
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 8.30E-39, Aligned region: 224..241
AAA_2 [PF07724], Evalue: 8.30E-39, Aligned region: 621..780
AAA [PF00004], Evalue: 6.40E-20, Aligned region: 224..357
AAA [PF00004], Evalue: 6.40E-20, Aligned region: 626..721
AAA_16 [PF13191], Evalue: 1.60E-14, Aligned region: 201..246
AAA_16 [PF13191], Evalue: 1.60E-14, Aligned region: 269..302
AAA_16 [PF13191], Evalue: 1.60E-14, Aligned region: 473..552
AAA_16 [PF13191], Evalue: 1.60E-14, Aligned region: 593..670
AAA_16 [PF13191], Evalue: 1.60E-14, Aligned region: 689..708
AAA_16 [PF13191], Evalue: 1.60E-14, Aligned region: 746..813
AAA_5 [PF07728], Evalue: 2.70E-13, Aligned region: 224..244
AAA_5 [PF07728], Evalue: 2.70E-13, Aligned region: 625..743
ClpB_D2-small [PF10431], Evalue: 2.30E-11, Aligned region: 788..862
AAA_22 [PF13401], Evalue: 2.70E-10, Aligned region: 223..305
AAA_22 [PF13401], Evalue: 2.70E-10, Aligned region: 333..384
AAA_22 [PF13401], Evalue: 2.70E-10, Aligned region: 623..660
Sigma54_activat [PF00158], Evalue: 1.00E-07, Aligned region: 205..238
Sigma54_activat [PF00158], Evalue: 1.00E-07, Aligned region: 596..726
IstB_IS21 [PF01695], Evalue: 7.80E-06, Aligned region: 210..246
IstB_IS21 [PF01695], Evalue: 7.80E-06, Aligned region: 625..645
AAA_25 [PF13481], Evalue: 1.00E-05, Aligned region: 206..263
AAA_25 [PF13481], Evalue: 1.00E-05, Aligned region: 623..654
AAA_17 [PF13207], Evalue: 3.60E-05, Aligned region: 224..248
AAA_17 [PF13207], Evalue: 3.60E-05, Aligned region: 624..660
Clp_N [PF02861], Evalue: 4.90E-05, Aligned region: 29..78
Clp_N [PF02861], Evalue: 4.90E-05, Aligned region: 111..136
NACHT [PF05729], Evalue: 6.50E-05, Aligned region: 224..251
NACHT [PF05729], Evalue: 6.50E-05, Aligned region: 625..652
AAA_18 [PF13238], Evalue: 0.0001, Aligned region: 224..247
AAA_18 [PF13238], Evalue: 0.0001, Aligned region: 626..654
Zeta_toxin [PF06414], Evalue: 0.00024, Aligned region: 224..245
Zeta_toxin [PF06414], Evalue: 0.00024, Aligned region: 617..665
AAA_14 [PF13173], Evalue: 0.00035, Aligned region: 224..305
AAA_14 [PF13173], Evalue: 0.00035, Aligned region: 624..706
Arch_ATPase [PF01637], Evalue: 0.00056, Aligned region: 202..238
Arch_ATPase [PF01637], Evalue: 0.00056, Aligned region: 276..308
Arch_ATPase [PF01637], Evalue: 0.00056, Aligned region: 624..660
Arch_ATPase [PF01637], Evalue: 0.00056, Aligned region: 693..707
TIP49 [PF06068], Evalue: 0.002, Aligned region: 224..245
TIP49 [PF06068], Evalue: 0.002, Aligned region: 272..304
TIP49 [PF06068], Evalue: 0.002, Aligned region: 594..661
RNA_helicase [PF00910], Evalue: 0.0023, Aligned region: 225..245
RNA_helicase [PF00910], Evalue: 0.0023, Aligned region: 626..647
RNA_helicase [PF00910], Evalue: 0.0023, Aligned region: 723..744
AAA_29 [PF13555], Evalue: 0.0032, Aligned region: 216..240
AAA_29 [PF13555], Evalue: 0.0032, Aligned region: 623..636
Hpr_kinase_C [PF07475], Evalue: 0.0034, Aligned region: 224..236
Hpr_kinase_C [PF07475], Evalue: 0.0034, Aligned region: 623..647
RuvB_N [PF05496], Evalue: 0.0079, Aligned region: 223..239
RuvB_N [PF05496], Evalue: 0.0079, Aligned region: 286..304
RuvB_N [PF05496], Evalue: 0.0079, Aligned region: 593..647
RuvB_N [PF05496], Evalue: 0.0079, Aligned region: 693..724
ResIII [PF04851], Evalue: 0.0086, Aligned region: 209..246
ResIII [PF04851], Evalue: 0.0086, Aligned region: 284..305
ResIII [PF04851], Evalue: 0.0086, Aligned region: 597..648
Protein Sequence: 889 a.a.     [Download]
>gi|77465475|ref|YP_354978.1| unnamed protein product [Rhodobacter sphaeroides 2.4.1]
MPRGSQETVKRKELVAKLNPTCLAAFSAAAQAAKARGNPYVELVHLIEALLAADRSDMALLMRAAGCDAG
RLSADVARAVDALPRGASAVEEFSDHLFHAIREGWTFGSLRFGDDRVRSGYLLLGALRVPVLEALLMRIS
GAFGQVDAESLSETFRDLTQGSAEGDAAPPPARPGAADGSALARYATDLTARAREGRLDPVVGRDPEIRQ
IIDILMRRRQNNPILTGEAGVGKTAVVEGLALRLARGDVPPPLRPVTLWMLDLGLMQAGASMKGEFEKRL
KSVIDEVHASDAPVILFIDEAHTLIGAGGAAGTGDAANLLKPALARGELRTIAATTWAEYKQHIEPDPAL
TRRFQVVRIEEPSEEAAIRMCRGVAAVLERHHRVEILDEAVGAAVRLSQRYLPARQLPDKAISLLDTACA
RVAVSQHATPAEVEDIDRRAQALALEAGILEREEAVGMDVTARRGEVEAARTAVAADRAAAEARWEAEKA
LVAEILELRARLRAEGDALDGTAAQAAEEAEPPKDDRAALLDRLRRCSRDLAEAQGERPLILPTVDRQAV
ASVVQDWTGIPMGRMLASRNERALGLADLLARRVVGQDHAMEAIASRIQTAQAGLGPPEKPLGVFLLCGP
SGVGKTETALALAEQLHGGEQALITINMSEFQEAHTVSTLKGSPPGYVGYGKGGILTEAVRRKPYSVILL
DEVEKAHPDVHEIFFQVFDKGRMDDSEGRQIDFRNTVILLTSNVGTDEIVEAAGQDLARVSATLRAPLLQ
VFPAALLGRMIVLPFLPLSDRMIAAIAGQKLEAIARRLKAGHGAELVLGEGVLETIRARCTEVESGGRMI
DAILSGTLLPELSRKLLERQLAGAAFSRVTLTGGPAGFSYAFETEADHA
 
Nucleotide Sequence: 2670 bp     [Download]
>gi|77464988|ref|NC_007494.1|:c544156-541487 Rhodobacter sphaeroides 2.4.1 chromosome 2, complete sequence
ATGCCGCGGGGCTCGCAGGAAACCGTCAAGCGGAAGGAACTGGTGGCGAAGCTGAACCCGACCTGTCTCG
CGGCCTTCTCGGCGGCGGCTCAGGCGGCGAAGGCACGCGGCAACCCCTATGTCGAGCTGGTCCATCTGAT
CGAGGCGCTGCTCGCCGCGGATCGGTCCGACATGGCGCTGCTGATGCGCGCGGCAGGCTGCGATGCCGGC
CGGCTCTCGGCCGATGTGGCCCGCGCGGTGGATGCGCTGCCGCGCGGGGCGAGCGCGGTGGAAGAATTTT
CCGACCATCTCTTCCACGCCATCCGCGAGGGCTGGACCTTCGGCAGCCTGCGGTTCGGCGACGACCGCGT
GCGCTCGGGATACCTCCTGCTCGGCGCGCTGCGGGTGCCCGTGCTCGAGGCGCTGCTCATGCGGATCAGC
GGCGCCTTCGGGCAGGTGGATGCGGAGTCTCTTTCCGAGACGTTCCGCGATCTGACGCAGGGCTCGGCCG
AGGGCGATGCCGCGCCGCCCCCCGCGCGGCCGGGCGCGGCCGACGGCTCCGCGCTCGCCCGCTATGCGAC
CGATCTGACGGCGCGGGCGCGGGAGGGGCGGCTCGATCCGGTCGTGGGGCGCGATCCCGAGATCCGGCAG
ATCATCGACATCCTGATGCGGCGGAGGCAGAACAATCCGATCCTCACCGGCGAGGCCGGGGTGGGCAAGA
CCGCCGTCGTCGAGGGCCTTGCGCTGCGGCTTGCCCGAGGGGACGTGCCGCCGCCGCTGCGCCCGGTGAC
CCTGTGGATGCTCGATCTCGGGCTGATGCAGGCGGGTGCCAGCATGAAGGGCGAGTTCGAGAAGCGGCTG
AAGAGCGTGATCGACGAGGTTCACGCCTCGGACGCCCCGGTGATCCTCTTCATCGACGAGGCCCATACGC
TGATCGGCGCGGGCGGCGCGGCGGGGACGGGGGACGCGGCCAATCTTCTCAAACCGGCACTGGCACGGGG
AGAGCTGCGCACCATCGCCGCCACCACCTGGGCCGAATACAAGCAGCATATCGAGCCCGACCCGGCGCTG
ACCCGCCGCTTTCAGGTTGTGCGGATCGAGGAGCCCTCGGAAGAGGCCGCGATCCGCATGTGCCGCGGCG
TGGCCGCCGTGCTGGAGCGCCATCACCGGGTCGAGATCCTCGACGAGGCGGTGGGGGCGGCGGTGCGGTT
GTCGCAGCGCTACCTGCCGGCCAGGCAATTGCCGGACAAGGCGATTTCCCTGCTCGACACCGCCTGCGCG
CGCGTCGCCGTCTCTCAGCATGCGACGCCGGCGGAGGTCGAGGACATCGACCGCCGCGCGCAGGCGCTCG
CGCTCGAGGCGGGCATCCTCGAGCGCGAGGAGGCCGTGGGCATGGATGTGACGGCGCGCCGCGGCGAGGT
CGAGGCGGCGCGGACCGCCGTCGCGGCCGACCGTGCCGCGGCGGAGGCGCGGTGGGAGGCCGAGAAGGCG
CTGGTGGCCGAAATTCTTGAACTGCGCGCCCGGCTGCGGGCAGAGGGCGATGCGCTGGACGGCACCGCGG
CGCAGGCCGCCGAGGAGGCCGAGCCGCCCAAGGACGACCGTGCGGCGCTTCTCGACCGGCTGCGGCGTTG
CAGCCGGGATCTCGCCGAGGCGCAGGGGGAGCGGCCGCTGATCCTGCCGACGGTCGACCGACAGGCGGTC
GCCTCGGTGGTGCAGGACTGGACCGGCATCCCGATGGGGCGGATGCTGGCCAGCCGCAACGAACGCGCGC
TCGGCCTTGCGGACCTGCTGGCCCGGCGCGTCGTGGGACAGGATCATGCGATGGAGGCCATCGCGAGCCG
GATCCAGACCGCGCAGGCGGGGCTCGGCCCGCCGGAGAAGCCGCTCGGCGTGTTTCTGCTCTGCGGGCCC
TCGGGCGTGGGCAAGACCGAGACGGCGCTGGCCTTGGCCGAACAGCTGCACGGTGGCGAGCAGGCTCTCA
TCACGATCAACATGAGCGAATTTCAGGAGGCGCATACGGTCTCGACGCTGAAGGGATCGCCCCCGGGCTA
TGTGGGCTATGGCAAGGGCGGCATCCTGACCGAGGCGGTGCGGCGAAAACCCTATTCGGTGATCCTGCTC
GACGAGGTCGAGAAGGCGCATCCCGATGTCCATGAAATATTCTTTCAGGTGTTCGACAAGGGAAGGATGG
ACGACAGCGAAGGGCGGCAGATCGATTTCCGCAATACGGTGATCCTGCTGACCTCGAACGTCGGCACCGA
CGAGATCGTGGAGGCGGCGGGGCAGGATCTGGCCCGGGTCTCGGCCACGCTCCGCGCGCCGCTTCTGCAG
GTCTTTCCGGCCGCGCTGCTGGGGCGGATGATCGTGCTGCCGTTCCTGCCGCTCTCGGACCGGATGATCG
CGGCCATCGCGGGGCAGAAGCTCGAGGCCATTGCCCGGCGGCTGAAGGCGGGGCACGGCGCCGAGCTGGT
TCTGGGCGAGGGCGTGCTCGAGACGATCCGCGCCCGCTGCACCGAGGTCGAGTCGGGGGGGCGGATGATC
GACGCGATCCTGAGCGGCACCCTGCTGCCGGAGCTGAGCCGCAAGCTTCTCGAGCGCCAGCTCGCGGGGG
CGGCCTTCAGCCGGGTGACCCTCACCGGCGGCCCCGCAGGCTTTTCCTATGCGTTCGAGACGGAGGCGGA
TCATGCATGA