SecReT6
Protein ID: 77465477
SecReT6 ID99
T6SS typei3
Gene symbol-
Locus tagRSP_3476
StrainRhodobacter sphaeroides 2.4.1
Repliconchromosome II [GenBank: NC_007494] [Browse all T6SS(s) in this replicon]
Location [Strand]546374..547447 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ3IWK5
KEGG IDrsp:RSP_3476
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.90E-19, Aligned region: 55..114
ImpA-rel_N [PF06812], Evalue: 2.90E-19, Aligned region: 213..229
Protein Sequence: 357 a.a.     [Download]
>gi|77465477|ref|YP_354980.1| unnamed protein product [Rhodobacter sphaeroides 2.4.1]
MSELREFLDPIEGDAPSGADLRNDPRFHAIERLIEPARRAARQAAAETGSQVQLDWSAIVAEARALAASG
RDLRLLVILLRALTAEEGLAGLASGLDLLARTVESYWDTLHPALREGPPQEAAMRRVNALRQIENADAGL
LGDLEFQPMFEMRALGAVTGGDLAAGGLRAAQVLAEAPRGLGARETSEIAAAHEARAARVAAACRGLKAE
RPAEFEGLAAGLAHAQAALGRLEAALAKELGTNGAGLRFTALSTQLQRMAATLGTATAEPAPLAAEAPAA
LPEAPALGIASRRDVERCLDLIIEFYERTEPSSPIPHLARRMRRMVPMNFLQLMEEVAPSGMKEFRAVAG
VADERTK
 
Nucleotide Sequence: 1074 bp     [Download]
>gi|77464988|ref|NC_007494.1|:546374-547447 Rhodobacter sphaeroides 2.4.1 chromosome 2, complete sequence
ATGTCGGAGCTACGGGAATTTCTCGATCCGATCGAAGGCGACGCTCCGTCGGGTGCGGACCTGCGGAACG
ATCCGCGCTTTCACGCCATCGAGCGTCTCATCGAACCGGCCCGACGCGCGGCCCGGCAGGCGGCCGCCGA
GACGGGCTCTCAAGTGCAGCTCGACTGGAGCGCCATCGTGGCCGAAGCGCGCGCGCTTGCGGCCTCGGGG
CGCGACCTCCGGCTTCTGGTGATCCTCCTGCGCGCGCTCACCGCCGAGGAGGGGCTGGCGGGGCTCGCCT
CGGGGCTCGACCTGCTGGCCCGGACGGTGGAGAGCTACTGGGACACGCTCCACCCCGCGCTGCGCGAGGG
GCCGCCGCAGGAGGCGGCCATGCGCCGGGTCAATGCGCTGCGCCAGATCGAGAATGCGGATGCGGGCCTT
CTCGGCGATCTCGAGTTCCAGCCGATGTTCGAGATGCGGGCTCTGGGCGCCGTCACGGGCGGCGACCTTG
CGGCGGGCGGCTTGCGCGCGGCGCAGGTGCTGGCCGAGGCCCCGCGCGGGCTCGGCGCGCGCGAGACCTC
GGAGATCGCCGCCGCGCACGAGGCGCGGGCCGCCCGTGTGGCTGCCGCCTGCCGCGGACTGAAGGCGGAG
CGGCCGGCGGAGTTCGAGGGCCTCGCCGCAGGGCTCGCCCATGCACAGGCGGCCCTCGGCCGGCTCGAGG
CGGCGCTGGCGAAAGAGCTCGGCACCAACGGCGCGGGGCTACGCTTCACGGCCCTCTCGACCCAGCTTCA
GCGCATGGCCGCGACCCTCGGCACCGCCACGGCAGAGCCCGCACCTCTCGCCGCAGAGGCCCCCGCCGCC
CTCCCCGAGGCCCCGGCCCTGGGGATCGCCTCGCGCCGCGATGTCGAGCGCTGCCTCGACCTCATCATCG
AGTTCTACGAGCGCACCGAACCCTCGTCGCCGATCCCGCATCTGGCGCGGCGGATGCGGCGGATGGTGCC
GATGAACTTCCTCCAGCTCATGGAGGAGGTCGCCCCCTCGGGCATGAAGGAATTCCGCGCCGTGGCCGGC
GTCGCGGACGAACGGACGAAATGA