SecReT6
Protein ID: 77465478
SecReT6 ID99
T6SS typei3
Gene symbol-
Locus tagRSP_3477
StrainRhodobacter sphaeroides 2.4.1
Repliconchromosome II [GenBank: NC_007494] [Browse all T6SS(s) in this replicon]
Location [Strand]547466..547996 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ3IWK4
KEGG IDrsp:RSP_3477
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.20E-53, Aligned region: 9..168
Protein Sequence: 176 a.a.     [Download]
>gi|77465478|ref|YP_354981.1| unnamed protein product [Rhodobacter sphaeroides 2.4.1]
MSESKAKVIERNRAPRVQIAYDVEHYGSPTTIELPFVMGVMADLAGKSETREAQKPAAERAFVEVDAGRF
GKFMEALSPRVKARVPNRLPGGAEGGEEEMFVDLSFRSMGDFAPDRMAEQVPALAELLRMRRQLEELLGY
MDGKVSAEKRIAQLLTNEPLLAQVAGEAVKSRQPEE
 
Nucleotide Sequence: 531 bp     [Download]
>gi|77464988|ref|NC_007494.1|:547466-547996 Rhodobacter sphaeroides 2.4.1 chromosome 2, complete sequence
ATGAGCGAGAGCAAGGCGAAGGTGATCGAACGCAACCGCGCTCCGCGGGTGCAGATCGCCTATGACGTGG
AGCATTACGGCAGCCCGACGACCATCGAGCTGCCCTTCGTGATGGGGGTCATGGCCGACCTCGCCGGCAA
GTCCGAGACGCGCGAGGCGCAGAAACCCGCGGCCGAGCGGGCCTTCGTCGAGGTGGATGCCGGCCGGTTC
GGCAAGTTCATGGAGGCGCTGAGCCCGCGGGTGAAGGCACGGGTCCCGAACCGGCTGCCCGGCGGGGCGG
AGGGCGGCGAGGAGGAGATGTTCGTCGATCTCAGCTTCCGCAGCATGGGCGATTTCGCCCCCGACCGCAT
GGCCGAGCAGGTGCCGGCGCTGGCCGAGCTCCTGCGGATGCGGCGCCAGCTCGAAGAGCTTCTCGGCTAC
ATGGACGGCAAGGTCAGTGCCGAGAAGCGCATCGCCCAGCTTCTGACGAACGAGCCGCTGCTCGCGCAGG
TCGCGGGCGAGGCCGTGAAGTCGCGTCAGCCGGAGGAATGA