SecReT6
Protein ID: 77465479
SecReT6 ID99
T6SS typei3
Gene symbol-
Locus tagRSP_3478
StrainRhodobacter sphaeroides 2.4.1
Repliconchromosome II [GenBank: NC_007494] [Browse all T6SS(s) in this replicon]
Location [Strand]547993..549510 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ3IWK3
KEGG IDrsp:RSP_3478
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.10E-178, Aligned region: 71..500
Protein Sequence: 505 a.a.     [Download]
>gi|77465479|ref|YP_354982.1| unnamed protein product [Rhodobacter sphaeroides 2.4.1]
MTMAEAKQDTGPATAETEALDLGEFSALLEKDFRVREDDSDKLKDLVRNLALAATERSGTATISGNAVKS
IKSLIAGIDALLSAQMNEILHAPEVRQIEGTWRGLHYLVNNTETDQKLKIRVMNITKDELADQLEDFEGQ
MWDQSPTFKKLYTEEYSMFGGAPFGAVIGAYEFSHHPRDVSLLRNISGICASAHAPFIAAAAPQLFRMES
WQELPNPQDLQQIVSSPDYASWQSLRESEDSRYIGLTLPRVLARLPYGAATIPVKGFAFEEEIDGKHDHY
VWMNAAFPMGVNINRSHKLYSWGTQIRGVETGGSVINLPVHTFPTDDGSVAMKCPTEIAIDDRREAELAR
LGMMPILHRKNTDIAAFIGAHSLQDDEARAGRLVDPDAQSNERLSANLPYLFPVCRFAHYLKAIARDKIG
SFKERADMQVWLSEWINRYVLANTAMADDKQKARRPLAAAEVQVDSVEGRPGYYAARFYLRPHYQLEGIN
ASLRLVSELPSVKGG
 
Nucleotide Sequence: 1518 bp     [Download]
>gi|77464988|ref|NC_007494.1|:547993-549510 Rhodobacter sphaeroides 2.4.1 chromosome 2, complete sequence
ATGACCATGGCCGAAGCCAAGCAGGACACTGGCCCCGCCACCGCCGAGACGGAGGCGCTGGATCTGGGCG
AGTTCAGTGCGCTTCTGGAAAAGGACTTCCGCGTCCGCGAGGACGACAGCGACAAGCTGAAGGATCTGGT
GCGCAACCTCGCCCTCGCAGCCACCGAGCGGTCGGGCACCGCCACCATCTCGGGCAATGCCGTCAAGTCG
ATCAAGTCGCTGATCGCGGGCATCGACGCGCTTCTTTCGGCGCAGATGAACGAGATCCTCCACGCGCCCG
AGGTGCGCCAGATCGAGGGGACATGGCGCGGGCTCCATTATCTCGTGAACAACACCGAGACCGACCAGAA
GCTGAAGATCCGGGTGATGAACATCACCAAGGACGAACTGGCCGACCAGCTCGAGGATTTCGAGGGCCAG
ATGTGGGACCAGTCGCCCACCTTCAAGAAGCTCTACACCGAGGAATATTCGATGTTCGGCGGCGCGCCCT
TCGGGGCGGTCATCGGGGCCTATGAATTCAGCCACCATCCGCGCGACGTAAGCCTCCTGCGCAACATCTC
GGGCATCTGCGCCTCGGCCCATGCGCCGTTCATCGCCGCGGCCGCCCCGCAGCTCTTCCGCATGGAGAGC
TGGCAGGAACTGCCCAATCCGCAGGATCTTCAGCAGATCGTCTCCTCGCCCGATTACGCCAGCTGGCAGT
CGCTGCGCGAGAGCGAGGACAGCCGCTACATCGGCCTCACGCTTCCGCGGGTGCTGGCCCGCCTGCCCTA
TGGCGCGGCCACGATCCCGGTAAAGGGCTTCGCCTTCGAGGAGGAGATCGACGGCAAGCACGACCATTAC
GTCTGGATGAACGCGGCCTTCCCGATGGGCGTCAACATCAACCGCAGCCACAAGCTCTACAGCTGGGGCA
CTCAGATCCGCGGCGTCGAGACCGGCGGCTCGGTCATCAACCTGCCCGTCCACACCTTCCCGACCGACGA
CGGTTCGGTGGCGATGAAATGCCCCACCGAGATCGCCATCGACGACCGGCGCGAGGCGGAACTCGCCAGA
CTCGGGATGATGCCGATCCTGCACCGCAAGAACACCGACATCGCGGCCTTCATCGGCGCTCACAGCCTGC
AGGACGACGAGGCCCGCGCCGGGCGGCTGGTCGATCCCGACGCGCAGTCGAACGAGCGGCTGAGCGCGAA
CCTGCCCTACCTCTTCCCCGTCTGCCGCTTCGCCCATTACCTCAAGGCCATCGCGCGCGACAAGATCGGC
AGCTTCAAGGAACGGGCCGACATGCAGGTCTGGCTGTCCGAGTGGATCAACCGCTATGTCCTCGCCAACA
CCGCCATGGCCGACGACAAGCAGAAGGCGCGCCGCCCGCTCGCCGCCGCCGAGGTGCAGGTCGACAGCGT
CGAGGGCCGCCCCGGCTACTATGCCGCGCGCTTCTACCTGCGGCCGCACTACCAGCTCGAGGGCATCAAC
GCGAGCCTGCGGCTCGTCTCGGAGCTGCCCTCCGTCAAGGGAGGCTGA