SecReT6
Protein ID: 77465480
SecReT6 ID99
T6SS typei3
Gene symbol-
Locus tagRSP_3479
StrainRhodobacter sphaeroides 2.4.1
Repliconchromosome II [GenBank: NC_007494] [Browse all T6SS(s) in this replicon]
Location [Strand]549562..550053 [+]
Producthypothetical protein
NoteTssD
UniProt IDQ3IWK2
KEGG IDrsp:RSP_3479
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.10E-36, Aligned region: 6..140
Protein Sequence: 163 a.a.     [Download]
>gi|77465480|ref|YP_354983.1| unnamed protein product [Rhodobacter sphaeroides 2.4.1]
MAFTGYLKIDDIKGESRRADHEDEIDAFGVSWLVEQTSSASTGSGRTRGRARVGDFRLRKWMDASSPYLA
LACMQGKSFPEMIFMARKDSGEAHLDYLQVTLKNCIVSSYALAQDAPEESGHDMIAEDVAISFETITYKY
VVQADDHSAGDEHEVEYNVVAAR
 
Nucleotide Sequence: 492 bp     [Download]
>gi|77464988|ref|NC_007494.1|:549562-550053 Rhodobacter sphaeroides 2.4.1 chromosome 2, complete sequence
ATGGCATTCACAGGCTACCTCAAGATCGACGACATCAAGGGCGAGTCGCGGCGCGCCGACCACGAGGACG
AGATCGACGCCTTCGGCGTGAGCTGGCTCGTCGAGCAGACGAGCTCGGCCTCGACCGGCAGCGGCCGGAC
GCGCGGCCGCGCCAGGGTGGGCGACTTCCGGCTGCGCAAATGGATGGACGCCTCTTCACCCTATCTCGCG
CTGGCCTGCATGCAGGGCAAGTCCTTCCCCGAGATGATCTTCATGGCCCGCAAGGACTCCGGCGAGGCGC
ATCTCGATTATCTGCAGGTGACGCTGAAGAACTGCATCGTCTCGAGCTATGCGCTCGCGCAGGATGCGCC
CGAGGAGTCGGGCCATGACATGATCGCCGAGGATGTGGCGATCTCGTTCGAGACCATCACCTACAAATAT
GTCGTTCAGGCCGACGACCATTCGGCCGGCGACGAGCACGAGGTCGAATATAACGTCGTCGCCGCCCGCT
GA