SecReT6
Protein ID: 77465482
SecReT6 ID99
T6SS typei3
Gene symbol-
Locus tagRSP_3481
StrainRhodobacter sphaeroides 2.4.1
Repliconchromosome II [GenBank: NC_007494] [Browse all T6SS(s) in this replicon]
Location [Strand]550793..552658 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ3IWK0
KEGG IDrsp:RSP_3481
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.10E-164, Aligned region: 5..620
Protein Sequence: 621 a.a.     [Download]
>gi|77465482|ref|YP_354985.1| unnamed protein product [Rhodobacter sphaeroides 2.4.1]
MDRAFLAYYEAELAELREAAAAFGTLHPTVGRNLSLDTVPCPDPYVERLLEGVAWLAARTRLKLDAEAQR
SVRNLLDWLWPDLAGPAPAMALATLHPGPQVLGMADGHTVRRGTRLVAAFREGLATRATYTTAQDVTLWP
VTLEAAGYLPDRGALKAAGLSEAMAGGAEAAIRLALARAGPGTLSELSLDRLDLCFAGSPRAPALFDAIH
GTCRRAAARGAADFERVPAPALVGIDGAEGLLPRLRPSFEGYRLIREYFLMPDRFHYLRLDGLQTAIRAA
TGRVEILLLLDRPRPALADVAASDFRLFVTPVVNLFEKECNAVEVDPRSAAHVVHPDRTRPRDFEILRLL
RVEDADSSGPEAVIEPLHAPAAQGGLGLFYTTERRPRRPGEDELRRGQTRTSHAGDDLYISLVRRPGATA
PAVRRLDIRALCTNRDLPILDDSPRLTLESGDPVARVELLSALRRPRPALAAGLPRMTREAEAQQDEVIW
RLAAQLSLDHLSLAETTDDAEPLRALLALYADRGDPAVARHARSIARVRARAVTERLDLPGPLCFGRGQE
VTLEVDETVLSGASTLLLSALLAQLFARQAAINAVVRLRTRLVQAQEEVTWPTIPGIRPPI
 
Nucleotide Sequence: 1866 bp     [Download]
>gi|77464988|ref|NC_007494.1|:550793-552658 Rhodobacter sphaeroides 2.4.1 chromosome 2, complete sequence
ATGGACCGCGCCTTCCTCGCCTATTACGAGGCAGAGCTCGCCGAGCTGCGCGAGGCGGCGGCCGCGTTCG
GCACCCTGCATCCGACGGTGGGGCGCAACCTCTCGCTCGATACGGTGCCCTGCCCGGACCCCTATGTGGA
ACGGCTGCTCGAAGGGGTGGCCTGGCTCGCGGCAAGGACCCGGCTCAAGCTCGACGCCGAGGCGCAGCGC
AGCGTGCGCAACCTGCTCGACTGGCTCTGGCCCGATCTCGCCGGGCCTGCGCCGGCCATGGCGCTCGCCA
CCCTTCACCCGGGGCCGCAGGTGCTGGGGATGGCGGACGGCCACACGGTGAGGCGCGGCACCCGCCTCGT
CGCGGCCTTCCGCGAGGGGCTGGCCACGCGCGCCACCTACACGACCGCGCAGGACGTGACCCTCTGGCCG
GTGACCCTCGAGGCGGCGGGATACCTGCCCGACCGCGGCGCCTTGAAGGCCGCGGGGCTCTCCGAGGCGA
TGGCGGGGGGCGCCGAGGCGGCCATCCGCCTCGCCCTCGCGCGCGCAGGGCCGGGCACGCTCTCCGAGCT
GTCGCTCGACCGGCTCGACCTCTGTTTCGCGGGCAGTCCGCGCGCGCCCGCGCTGTTCGACGCGATCCAC
GGCACCTGTCGGCGGGCGGCGGCCCGCGGCGCGGCGGATTTCGAGCGGGTGCCGGCCCCCGCCCTCGTCG
GCATCGACGGGGCGGAGGGACTGCTGCCGCGCCTGCGCCCCTCCTTCGAGGGCTACCGGCTGATCCGCGA
ATATTTCCTGATGCCGGATCGGTTCCACTACCTGCGCCTCGACGGGCTGCAGACAGCCATCCGCGCGGCG
ACGGGACGGGTCGAGATCCTGTTGCTCCTCGACCGTCCGCGGCCGGCGCTGGCGGACGTCGCGGCGTCGG
ACTTCCGGCTGTTCGTGACGCCCGTGGTCAATCTCTTCGAGAAGGAATGCAATGCGGTCGAGGTCGATCC
CCGCTCGGCCGCGCATGTCGTGCACCCGGACCGCACAAGGCCGCGCGACTTCGAGATCCTGCGCCTGCTG
CGGGTCGAGGATGCCGACAGCTCCGGCCCCGAGGCGGTGATCGAGCCCCTGCATGCGCCCGCGGCCCAGG
GGGGCTTGGGTCTTTTCTATACCACCGAGCGCCGCCCCCGCCGCCCCGGCGAGGACGAGCTGCGCCGGGG
GCAGACCCGGACGAGCCACGCGGGCGACGATCTTTACATCTCGCTCGTGCGGCGTCCGGGCGCGACGGCG
CCTGCCGTCCGGCGGCTCGACATCCGCGCGCTCTGCACCAACCGCGACCTGCCGATCCTCGACGACAGCC
CGCGCCTCACGCTCGAAAGCGGCGATCCGGTGGCGCGGGTCGAGCTTCTGTCGGCGCTCCGCCGCCCCCG
TCCCGCGCTGGCCGCCGGGCTGCCGCGCATGACCCGCGAAGCGGAGGCGCAGCAGGACGAGGTCATCTGG
CGCCTCGCCGCGCAGCTCTCGCTCGATCATCTGTCGCTCGCCGAGACGACCGACGACGCCGAACCGCTGC
GCGCGCTGCTCGCGCTCTATGCCGACCGCGGCGACCCGGCCGTGGCCCGCCATGCGCGGTCCATCGCCCG
GGTGCGGGCGCGCGCCGTGACCGAGCGGCTGGATCTGCCCGGCCCGCTCTGCTTCGGCCGCGGACAGGAG
GTGACGCTCGAAGTCGACGAGACGGTGCTGAGCGGGGCGAGCACGCTTCTTCTGTCCGCGCTGCTCGCGC
AGCTCTTCGCGCGGCAGGCGGCGATCAACGCGGTCGTCCGGCTGCGCACGCGGCTGGTTCAGGCACAGGA
GGAGGTGACATGGCCGACGATCCCCGGCATCCGCCCCCCGATCTGA