SecReT6
Protein ID: 77465483
SecReT6 ID99
T6SS typei3
Gene symbol-
Locus tagRSP_3482
StrainRhodobacter sphaeroides 2.4.1
Repliconchromosome II [GenBank: NC_007494] [Browse all T6SS(s) in this replicon]
Location [Strand]552622..553620 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ3IWJ9
KEGG IDrsp:RSP_3482
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.40E-68, Aligned region: 16..308
Protein Sequence: 332 a.a.     [Download]
>gi|77465483|ref|YP_354986.1| unnamed protein product [Rhodobacter sphaeroides 2.4.1]
MADDPRHPPPDLSPATGFFELLRRLEAPELRFGRTGPEPARLGQRVRLSMAARDVAALRPGAPPFVEVEV
LGLLGPEGPMPLHLTRWLMQRLSDRWFEGTDGGTADTTALDFLNMIQHRLLALYWRAWADQRPEVQAAFG
TGRLGAMIDALAGLGLPGPRPARLDGVKRRHATSLASGIQSPARLTDLVACHLGAPSTLREFLPHWMPIP
LPLQSRLGHQHARLGRGAVAGARSFQRQTRAELRVGPVDLPLYLRLIEDPALAADLRHLVGVAAPREVTV
GLRPLLRRAAIPAPRLGSVRLGRTLWLAGGRHRDAEDWRRPSLLPAEGEAGC
 
Nucleotide Sequence: 999 bp     [Download]
>gi|77464988|ref|NC_007494.1|:552622-553620 Rhodobacter sphaeroides 2.4.1 chromosome 2, complete sequence
ATGGCCGACGATCCCCGGCATCCGCCCCCCGATCTGAGCCCCGCCACGGGCTTCTTCGAGCTGCTGCGCC
GGCTGGAGGCGCCGGAACTCCGCTTCGGCCGCACCGGCCCCGAGCCCGCGCGGCTCGGCCAGCGCGTGCG
GCTGTCGATGGCGGCGCGCGACGTGGCGGCGCTGCGCCCCGGCGCGCCGCCCTTCGTCGAGGTCGAGGTG
CTGGGCCTTCTCGGCCCCGAGGGGCCGATGCCCCTGCATCTCACGCGCTGGCTGATGCAGCGCCTGTCCG
ACCGCTGGTTCGAGGGCACCGACGGCGGCACCGCCGATACGACGGCGCTCGATTTCCTCAACATGATCCA
GCATCGGCTGCTCGCGCTCTACTGGCGCGCCTGGGCCGACCAGAGGCCCGAGGTGCAGGCAGCCTTCGGC
ACGGGGCGGCTCGGGGCCATGATCGACGCCCTCGCCGGTCTGGGCCTGCCCGGGCCGCGGCCTGCCCGGC
TCGACGGCGTGAAGCGGCGGCACGCGACCTCGCTCGCCTCCGGGATCCAGAGCCCCGCGCGGCTGACGGA
TCTGGTGGCCTGCCATCTCGGCGCGCCAAGCACGCTTCGTGAATTTCTGCCGCACTGGATGCCGATCCCG
CTGCCGCTGCAGAGCCGGCTCGGCCACCAGCACGCCCGCCTCGGCCGCGGCGCGGTGGCCGGGGCGCGCA
GCTTCCAGCGCCAGACCCGGGCCGAGCTGCGCGTGGGGCCGGTGGATCTGCCGCTCTACCTGCGCCTGAT
CGAGGATCCGGCGCTCGCCGCCGACCTGCGCCATCTGGTGGGCGTGGCCGCCCCGCGCGAGGTGACGGTG
GGGCTGCGGCCCCTCCTGCGGCGCGCGGCGATCCCCGCCCCGCGCCTCGGCTCGGTGCGGCTCGGCCGGA
CGCTCTGGCTGGCGGGCGGCCGCCACCGCGACGCCGAGGACTGGCGGCGGCCAAGCCTTCTTCCCGCAGA
GGGAGAGGCCGGATGCTGA