SecReT6
Protein ID: 77465484
SecReT6 ID99
T6SS typei3
Gene symbol-
Locus tagRSP_3483
StrainRhodobacter sphaeroides 2.4.1
Repliconchromosome II [GenBank: NC_007494] [Browse all T6SS(s) in this replicon]
Location [Strand]553614..554843 [+]
Producthypothetical protein
NoteFha
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 9.70E-12, Aligned region: 26..94
Protein Sequence: 409 a.a.     [Download]
>gi|77465484|ref|YP_354987.1| unnamed protein product [Rhodobacter sphaeroides 2.4.1]
MLRLVIEHAPCPQRVGEMRLEAGELSIGRGADCDWHIDDPDMFVSRRHCIVSGGEGGWLVIDASRGGLFL
DGSESPLGAGNSAVLAQGTRLRLGDVVLRAEIEGREPLRAPLAPREAALAVDDFFAAPRAVTPEPPPRPK
DLPGPFEAVERAPAPPPQDDFGFGWALPAQVRPPPAEARKTEGQDPFFRPGTATENPSLEASPAPPQARS
APRELALSEDALSEAFFHGLGLPSEALDTAAMEAMGRRFRLLAEGLVLLLRARSREKGAARVPQSVIGAS
EVNPLKFLVTLDEAVAALVTPRGPGYLGPEASIEGAFRDLTDHQLRNWIAVQAALRRMIDRFDPARFEAE
SEREGRMAQLLAGGRSARLWQLYLDRYEELARAAEDRFLGEVGADFREAYEGPERRENG
 
Nucleotide Sequence: 1230 bp     [Download]
>gi|77464988|ref|NC_007494.1|:553614-554843 Rhodobacter sphaeroides 2.4.1 chromosome 2, complete sequence
ATGCTGAGGCTCGTCATCGAACATGCGCCCTGCCCGCAGCGCGTGGGCGAGATGCGGCTCGAAGCGGGCG
AACTCTCGATCGGGCGCGGTGCCGACTGCGACTGGCACATCGACGACCCGGACATGTTCGTCTCGCGCAG
GCACTGCATCGTCTCTGGCGGCGAGGGCGGCTGGCTGGTGATCGACGCAAGCCGGGGCGGGCTGTTCCTC
GACGGGTCCGAGAGCCCGCTCGGCGCGGGAAATTCCGCGGTGCTGGCGCAGGGCACCCGGCTCCGGCTGG
GCGATGTCGTGCTGCGCGCCGAGATCGAGGGGCGCGAGCCCCTGCGCGCGCCGCTCGCGCCGCGCGAGGC
GGCGCTGGCGGTCGACGATTTCTTCGCGGCGCCCCGCGCGGTGACGCCCGAGCCTCCGCCGCGGCCGAAG
GATCTGCCGGGACCGTTCGAGGCGGTGGAGCGGGCGCCCGCCCCGCCGCCGCAGGATGACTTCGGCTTCG
GCTGGGCCCTGCCCGCGCAAGTTCGCCCGCCCCCCGCCGAGGCGCGCAAAACGGAGGGACAGGACCCGTT
CTTCAGGCCGGGCACCGCGACGGAGAACCCTTCCCTGGAAGCATCCCCGGCCCCACCTCAGGCGAGGTCC
GCGCCAAGGGAGCTCGCCTTGTCGGAGGACGCCCTGTCCGAGGCCTTCTTCCACGGCCTGGGCCTTCCGT
CCGAAGCCCTCGACACGGCGGCGATGGAGGCGATGGGCCGCCGCTTCCGGCTGCTGGCCGAGGGGCTCGT
CCTGCTGCTGCGCGCCCGCTCCCGCGAGAAGGGCGCCGCCCGCGTTCCGCAGAGCGTGATCGGGGCTTCG
GAGGTGAACCCGCTGAAATTCCTCGTCACGCTCGACGAGGCAGTGGCCGCGCTGGTGACGCCGCGGGGGC
CGGGATATCTCGGCCCCGAGGCTTCCATCGAGGGCGCCTTCCGCGACCTCACCGACCATCAGCTGCGCAA
CTGGATCGCGGTGCAGGCCGCGCTGCGCCGGATGATCGACCGGTTCGATCCCGCGCGCTTCGAGGCCGAG
AGCGAGCGCGAGGGCCGGATGGCGCAGCTCCTCGCCGGAGGCCGCAGCGCGCGGCTCTGGCAGCTGTATC
TCGACCGTTACGAAGAGCTCGCCCGCGCGGCCGAGGACCGGTTCCTCGGCGAGGTCGGGGCCGATTTCAG
GGAGGCCTACGAGGGCCCGGAGAGGAGAGAGAATGGCTGA