SecReT6
Protein ID: 77465486
SecReT6 ID99
T6SS typei3
Gene symbol-
Locus tagRSP_3485
StrainRhodobacter sphaeroides 2.4.1
Repliconchromosome II [GenBank: NC_007494] [Browse all T6SS(s) in this replicon]
Location [Strand]555297..556625 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ3IWJ6
KEGG IDrsp:RSP_3485
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.60E-116, Aligned region: 18..440
Protein Sequence: 442 a.a.     [Download]
>gi|77465486|ref|YP_354989.1| unnamed protein product [Rhodobacter sphaeroides 2.4.1]
MSGNRVVWSEGLFLRTQHFQQQDRHAEALLRAALLAAPWQPFGFTRLALDAAALDAGRVALAEAEALMPD
GTAFRLTEAEPPPAAALRRDGPPGLVQLALPLEQEGAASVDPAHAAPSGARYRGRIEVLRDAIRGGAEPE
EVELARLAPRLIAPGEPADGCVTLPVARVEGLRADGSVALQEGWLPPALTIGAVPWYGALLQELVTGLDR
VADAHGGLVLGGAGRSIENLLILELANTARPRLAHLLQQAQEHPSALYAELAALAGRMATYGSSSRRLSA
LAPYDHLEPQPAFAALADTLRSLLLSLRHVEPKSRALPVARHAQNIWKVRIDNPEILRSSRIVLRVGSEM
SDESLRRLFADQATVGAADAFERLWTSRLPGIPLKPLHSQPREIPYDGERLCLELDQKSEHWSQLLEAPG
FVVGVSGVLEREPQIDCYAVSR
 
Nucleotide Sequence: 1329 bp     [Download]
>gi|77464988|ref|NC_007494.1|:555297-556625 Rhodobacter sphaeroides 2.4.1 chromosome 2, complete sequence
ATGAGCGGCAACAGGGTGGTCTGGTCGGAAGGGCTCTTCCTCAGGACCCAGCACTTCCAGCAGCAGGACC
GGCACGCGGAGGCGCTGCTGCGCGCGGCGCTCCTTGCCGCGCCCTGGCAGCCCTTCGGCTTCACCCGGCT
CGCGCTCGATGCGGCGGCGCTCGACGCAGGCCGCGTGGCGCTCGCCGAGGCGGAGGCGCTGATGCCGGAC
GGCACGGCCTTCCGCCTGACCGAGGCCGAGCCGCCGCCGGCCGCGGCGCTCCGCCGCGACGGGCCGCCGG
GCCTCGTCCAGCTGGCGCTGCCGCTCGAGCAGGAGGGGGCGGCGAGTGTCGATCCCGCCCATGCCGCACC
CTCGGGTGCGCGCTACCGGGGCCGGATCGAGGTGCTGCGCGATGCGATCCGCGGCGGCGCCGAGCCCGAG
GAGGTGGAGCTCGCGCGGCTCGCCCCGCGGCTGATCGCGCCGGGAGAGCCCGCGGACGGCTGCGTGACGC
TGCCCGTGGCGCGCGTCGAGGGGCTGCGCGCGGACGGATCCGTGGCCCTGCAGGAGGGATGGCTGCCCCC
TGCCCTCACCATCGGCGCCGTGCCCTGGTATGGCGCGCTGCTTCAGGAGCTGGTGACGGGGCTCGACCGG
GTGGCCGATGCCCATGGCGGGCTCGTGCTGGGCGGCGCCGGGCGCTCGATCGAGAACCTGCTGATCCTCG
AACTGGCCAACACCGCGCGCCCGCGCCTTGCCCACCTGCTCCAGCAGGCGCAGGAACATCCATCGGCGCT
CTATGCCGAGCTGGCCGCGCTCGCCGGGCGGATGGCGACCTACGGCTCCTCCTCGCGCCGGCTGAGCGCG
CTTGCGCCCTACGACCATCTCGAGCCACAGCCGGCCTTCGCGGCGCTGGCCGACACGCTGCGTTCGCTTC
TTCTGTCGCTGCGCCATGTCGAGCCGAAGTCGCGGGCGCTGCCGGTGGCGCGCCACGCGCAGAACATCTG
GAAGGTCCGCATCGACAATCCCGAGATCCTGCGCTCCTCGCGCATCGTGCTGCGCGTGGGCTCGGAGATG
TCGGACGAGAGCCTGCGCCGGCTCTTCGCCGATCAGGCGACGGTGGGCGCGGCCGATGCCTTCGAGCGGC
TCTGGACCTCGCGCCTGCCGGGCATCCCGCTGAAGCCGCTCCATTCCCAGCCGCGCGAGATCCCCTACGA
CGGCGAGCGGCTCTGCCTCGAGCTCGACCAGAAATCCGAGCACTGGTCGCAACTCCTCGAGGCGCCGGGC
TTCGTGGTGGGGGTTTCGGGCGTGCTCGAGCGCGAGCCGCAGATCGATTGCTATGCGGTGAGCCGATGA