SecReT6
Protein ID: 77465487
SecReT6 ID99
T6SS typei3
Gene symbol-
Locus tagRSP_3486
StrainRhodobacter sphaeroides 2.4.1
Repliconchromosome II [GenBank: NC_007494] [Browse all T6SS(s) in this replicon]
Location [Strand]556690..558051 [+]
ProductOmpA family outer membrane protein
NoteTssL
UniProt IDQ3IWJ5
KEGG IDrsp:RSP_3486
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.60E-53, Aligned region: 55..260
OmpA [PF00691], Evalue: 7.10E-15, Aligned region: 341..443
Protein Sequence: 453 a.a.     [Download]
>gi|77465487|ref|YP_354990.1| unnamed protein product [Rhodobacter sphaeroides 2.4.1]
MTREDDPFGLATDAARTRIRPSPAERARRAAAGPAPAEVGAVAPVRPAHGRTHANPLVASFALLLELAPA
LEGTAPPQEPGMLRARLRDGLTEARDRSVAQGVPLARADRAAWFVAALLDDLALNTPWGAASGWPRQPLV
TELSGEVDAGTRFFDRLEELARHPTLDPQLLELAWLCLSLGFRGKHRTGREGGESALFALRTGVARLLRN
PEAAAAPLSPHWEGVAAPDAPRRFAVPVWTVGLAALALMAALYTGLSLQLSARAEKLFDLAALVPPAERA
ALFRPPRETVAPPHEIRVEPVVIELLPAFRACAPAATAAALQGREDAQLTILTLQGTDPELFRSARAEVN
ADYAPLVASVAAVLAENRELVGAVRVIGHTDNVPVQRSNPFASNQGLSEARAATLAALLVEGGVPAGIVT
AEGHADSEPVADNATRAGRAQNRRVEIRIEKRL
 
Nucleotide Sequence: 1362 bp     [Download]
>gi|77464988|ref|NC_007494.1|:556690-558051 Rhodobacter sphaeroides 2.4.1 chromosome 2, complete sequence
ATGACGCGGGAGGACGATCCGTTCGGTCTGGCGACCGATGCCGCCCGCACCCGGATCAGGCCTTCTCCCG
CCGAACGGGCGCGCCGGGCCGCGGCCGGGCCTGCTCCGGCCGAGGTGGGCGCTGTGGCCCCGGTCCGCCC
GGCCCACGGAAGGACCCATGCCAATCCGCTTGTCGCGAGCTTCGCTCTCCTCCTCGAACTCGCGCCCGCG
CTGGAAGGCACCGCCCCGCCGCAGGAGCCGGGGATGCTGCGTGCGCGGCTCCGCGACGGCCTGACCGAAG
CCCGCGACCGGAGCGTGGCGCAGGGCGTGCCGCTGGCGCGCGCCGACCGCGCCGCCTGGTTCGTGGCGGC
GCTCCTCGACGATCTGGCCCTGAACACGCCCTGGGGTGCGGCCAGCGGATGGCCGCGCCAGCCGCTCGTG
ACCGAGCTGTCGGGCGAGGTCGATGCGGGCACCCGCTTCTTCGACCGGCTCGAAGAGCTCGCGCGCCATC
CGACGCTCGACCCGCAGCTGCTGGAGCTGGCCTGGCTCTGCCTGTCGCTCGGCTTTCGCGGCAAGCACCG
GACGGGGCGGGAGGGCGGCGAGAGCGCGCTCTTCGCGCTCCGCACCGGCGTAGCGCGCCTTCTGCGCAAT
CCGGAGGCTGCGGCCGCGCCGCTCTCGCCGCACTGGGAGGGGGTCGCCGCTCCCGACGCGCCGCGCCGCT
TCGCGGTGCCGGTCTGGACGGTGGGCCTTGCGGCGCTTGCGCTGATGGCCGCCCTTTACACGGGCCTCTC
GCTGCAACTGTCGGCGCGGGCCGAGAAGCTCTTCGATCTGGCGGCCCTCGTGCCGCCGGCCGAGCGCGCG
GCCCTGTTCCGCCCCCCGCGCGAAACGGTCGCGCCGCCCCACGAAATCAGGGTAGAACCGGTGGTGATCG
AGCTCCTGCCCGCCTTCCGCGCCTGCGCCCCCGCCGCCACCGCGGCCGCCCTTCAGGGCCGCGAGGATGC
GCAGCTCACCATCCTGACGCTTCAGGGCACCGACCCCGAGCTGTTCCGCTCGGCCCGCGCCGAGGTGAAC
GCGGATTATGCGCCGCTGGTGGCCTCGGTCGCGGCCGTCCTCGCGGAGAACCGCGAGCTGGTGGGGGCGG
TCCGTGTGATCGGCCACACGGACAATGTGCCGGTCCAGCGCAGCAATCCCTTCGCCTCGAACCAGGGCCT
GTCCGAGGCCCGCGCCGCCACCCTCGCGGCCCTCCTCGTCGAGGGCGGCGTGCCCGCGGGGATCGTCACC
GCCGAGGGCCATGCCGACAGCGAGCCCGTCGCCGACAATGCCACGCGCGCGGGCCGGGCGCAGAACCGCC
GCGTCGAGATCCGCATCGAGAAGAGGCTCTAA