SecReT6
Protein ID: 77465490
SecReT6 ID99
T6SS typei3
Gene symbol-
Locus tagRSP_3489
StrainRhodobacter sphaeroides 2.4.1
Repliconchromosome II [GenBank: NC_007494] [Browse all T6SS(s) in this replicon]
Location [Strand]562063..564366 [-]
Producthypothetical protein
NoteTssI
UniProt IDQ3IWJ2
KEGG IDrsp:RSP_3489
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.50E-77, Aligned region: 27..325
Phage_GPD [PF05954], Evalue: 3.50E-77, Aligned region: 572..617
Phage_base_V [PF04717], Evalue: 1.30E-24, Aligned region: 200..217
Phage_base_V [PF04717], Evalue: 1.30E-24, Aligned region: 365..457
Gp5_C [PF06715], Evalue: 1.00E-16, Aligned region: 500..521
Gp5_C [PF06715], Evalue: 1.00E-16, Aligned region: 531..554
Gp5_C [PF06715], Evalue: 1.00E-16, Aligned region: 556..577
Gp5_C [PF06715], Evalue: 1.00E-16, Aligned region: 580..594
Gp5_C [PF06715], Evalue: 1.00E-16, Aligned region: 598..618
Gp5_C [PF06715], Evalue: 1.00E-16, Aligned region: 624..642
Gp5_C [PF06715], Evalue: 1.00E-16, Aligned region: 644..666
Gp5_C [PF06715], Evalue: 1.00E-16, Aligned region: 676..692
Protein Sequence: 767 a.a.     [Download]
>gi|77465490|ref|YP_354993.1| unnamed protein product [Rhodobacter sphaeroides 2.4.1]
MSEAREITLSLPAATEDLWFSALEGEDGLGRPFRYELLLASKSLDLGAADILGTPVLVTVRGEVPRHFHG
IATAFGLDEIRDDHAHYRLTMEPSMALLGLRRDNRIFQDRSVPEILEAVLGEIPGLDWDFRLQASYPPRD
YCVQYGETDLDFVQRLMEHEGIGYFFEHEAEGHRLVLFDTNARLAPAPGAEILPYEPDSRVSFRDGDFIT
AWLPRAHIRPGKVSQGDYDFEKPSSDLTSRAENPLGHAADGAEHYRWPGDYRTLPAGDRLSRLRLEEAQA
PQVRIEARGTARPLWPGRIFRLDLFPREAENDDYLVTACRYRLWDDQFRSGQSRAEVGYEVDLSLVPARV
PYRPERRTPRPVMKGPQTALVVGPAGAEIFTDRYARVKVHFFWDRLDARNEASSCFVRVSQTWAGAGWGF
IQIPRIGQEVIVDFIEGDPDRPIVTGRVYNAEQMPPYGLPGQATQSGWKSHSSPGGGGWNELRFEDKAGA
EEVYFQAQKDHTELIKNDESRTIGHDFAEDVGHDAVQSVAHDRRESVGNDKDTSVGRNRTVSIGVDDSES
VGANRALRVGADETIAVARNATETIGMNHTQTVGIAQTVTVGAARTDSVGGAETRSVGAVQTNTIAASRS
VSVGAGQTHSVGADDGWTVGGSQTVSVGADQSVTVGAKQTVSTGSDQVTTVGGSRATQVAKDDLQKADGA
MGIGVGKSYTLDVKDEITLKCGSAEITLKKDGTIVLKGKDITLDASGKINLKAGGEITGKGSKINLN
 
Nucleotide Sequence: 2304 bp     [Download]
>gi|77464988|ref|NC_007494.1|:c564366-562063 Rhodobacter sphaeroides 2.4.1 chromosome 2, complete sequence
ATGTCCGAGGCCCGCGAAATCACCCTGTCCCTTCCCGCCGCGACCGAGGATCTGTGGTTCTCGGCGCTCG
AGGGCGAGGACGGGCTGGGGCGCCCGTTCCGCTACGAGCTGCTCCTCGCCAGCAAGTCGCTCGATCTCGG
CGCGGCCGACATCCTCGGCACGCCGGTGCTGGTGACGGTGCGGGGCGAGGTGCCGCGCCATTTCCACGGC
ATTGCCACCGCCTTCGGGCTGGACGAGATCCGCGACGACCATGCCCATTACCGGCTGACGATGGAGCCCT
CCATGGCGCTCCTCGGCCTGCGGCGCGACAACCGGATCTTCCAGGACCGCTCGGTGCCCGAGATCCTCGA
GGCCGTCCTGGGGGAGATCCCCGGCCTCGACTGGGATTTCAGGCTGCAGGCCAGCTATCCGCCGCGCGAC
TACTGCGTGCAGTATGGCGAAACCGATCTCGATTTCGTGCAGCGGCTGATGGAGCATGAGGGGATCGGCT
ATTTCTTCGAGCATGAGGCAGAGGGCCACAGGCTCGTCCTCTTCGACACGAATGCCCGGCTCGCGCCCGC
GCCGGGGGCCGAGATCCTGCCCTACGAGCCCGACAGCCGGGTGAGCTTCCGCGACGGCGACTTCATCACC
GCCTGGCTGCCCCGGGCGCATATCCGGCCGGGAAAGGTCTCGCAGGGCGACTACGATTTCGAGAAGCCCT
CGTCGGACCTGACGAGCCGCGCCGAAAATCCGCTCGGCCATGCGGCCGACGGTGCCGAGCACTATCGCTG
GCCCGGGGATTACCGCACCCTCCCCGCGGGCGACCGGCTGTCCCGGCTCCGGCTGGAGGAGGCGCAGGCG
CCGCAGGTGCGCATCGAGGCCCGCGGCACCGCGCGGCCGCTCTGGCCGGGCCGGATCTTCCGGCTCGATC
TCTTCCCGCGCGAGGCGGAGAACGACGACTATCTCGTCACCGCCTGCCGCTACCGGCTCTGGGACGATCA
GTTCCGCTCGGGTCAGTCGCGCGCCGAGGTGGGCTACGAGGTGGATCTGTCGCTCGTCCCCGCCCGCGTC
CCCTACCGGCCCGAGCGGCGCACCCCGCGCCCGGTGATGAAGGGGCCGCAGACCGCCCTCGTGGTCGGGC
CCGCGGGCGCGGAGATCTTCACCGACAGATATGCGCGGGTGAAGGTGCATTTCTTCTGGGACCGGCTCGA
CGCCCGCAACGAGGCCTCCTCCTGCTTCGTCCGCGTGAGCCAGACCTGGGCCGGGGCCGGCTGGGGGTTT
ATCCAGATCCCCCGGATCGGGCAGGAGGTCATCGTCGATTTCATCGAGGGCGATCCCGACCGCCCCATCG
TCACGGGCCGGGTCTACAATGCCGAGCAGATGCCGCCCTACGGCCTGCCGGGCCAGGCCACCCAGTCGGG
CTGGAAGTCGCACTCCTCGCCCGGAGGCGGCGGCTGGAACGAGCTGCGCTTCGAGGACAAGGCGGGTGCG
GAGGAGGTCTATTTCCAGGCGCAGAAGGACCATACCGAGCTCATCAAGAACGACGAGAGCCGCACCATCG
GCCATGATTTCGCCGAGGATGTGGGCCATGACGCCGTGCAGTCCGTGGCGCACGACCGCAGGGAGAGCGT
GGGCAACGACAAGGACACGAGCGTGGGCCGGAACCGCACCGTCTCGATCGGCGTCGACGACAGCGAGAGC
GTGGGCGCGAACCGCGCGCTGCGGGTCGGCGCGGACGAGACGATCGCGGTGGCGCGGAATGCGACCGAGA
CCATCGGCATGAACCACACCCAGACGGTCGGCATCGCCCAGACGGTGACGGTCGGGGCGGCGCGCACCGA
CAGTGTCGGCGGGGCCGAGACACGCTCGGTCGGCGCGGTCCAGACCAACACCATCGCCGCAAGCCGCAGC
GTCTCGGTAGGCGCGGGTCAGACCCATTCGGTGGGCGCCGACGACGGCTGGACCGTGGGCGGGTCGCAGA
CCGTCTCGGTCGGCGCGGACCAGTCGGTGACGGTGGGGGCGAAACAGACGGTCAGCACCGGCTCGGATCA
GGTGACCACCGTCGGCGGCTCCCGCGCCACGCAGGTGGCCAAGGACGACCTGCAGAAGGCCGACGGCGCC
ATGGGCATCGGCGTGGGCAAGAGCTACACGCTCGACGTCAAGGACGAGATCACCCTGAAATGCGGCTCGG
CCGAGATCACGCTGAAGAAGGACGGCACCATCGTCCTCAAGGGCAAGGACATCACGCTGGACGCCTCGGG
CAAGATCAACCTCAAGGCCGGCGGCGAGATCACCGGCAAGGGCTCGAAGATCAACCTGAACTGA