SecReT6
Protein ID: 77920398
SecReT6 ID100
T6SS typei2
Gene symbol-
Locus tagPcar_2808
StrainPelobacter carbinolicus DSM 2380
Repliconchromosome [GenBank: NC_007498] [Browse all T6SS(s) in this replicon]
Location [Strand]3275129..3275593 [+]
Producthypothetical protein
NoteTssJ
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.20E-31, Aligned region: 17..132
Protein Sequence: 154 a.a.     [Download]
>gi|77920398|ref|YP_358213.1| hypothetical protein Pcar_2808 [Pelobacter carbinolicus DSM 2380]
MPQFSFMRWFVTIPFCIMLCACSTPQVKMNLSSTANLNLNSAKEPLPVVVRIYQLSDPKVFENATFNELW
KNDLAVLGNSLLRKDILTLDPASQQKFRFERHEQTRFVALMAAFNKQPNDSWRVVKKVNGSFLGIKVSTK
IKAILKNNIIELED
 
Nucleotide Sequence: 465 bp     [Download]
>gi|90960985|ref|NC_007498.2|:3275129-3275593 Pelobacter carbinolicus DSM 2380 chromosome, complete genome
ATGCCTCAGTTCTCTTTTATGCGCTGGTTTGTGACCATCCCCTTTTGCATCATGCTTTGTGCCTGCTCCA
CTCCGCAGGTAAAAATGAATCTATCTTCCACGGCCAATCTTAATTTAAACAGCGCAAAAGAACCGCTGCC
GGTTGTGGTGCGCATCTACCAACTGAGCGACCCAAAAGTCTTTGAGAACGCCACATTTAACGAACTATGG
AAAAACGACCTGGCAGTGCTTGGAAACAGTCTGTTGCGAAAAGACATTCTAACCCTTGATCCAGCTTCCC
AGCAGAAGTTTCGTTTTGAGCGGCATGAGCAAACCCGTTTTGTGGCCCTGATGGCCGCTTTTAATAAACA
GCCGAATGATTCGTGGCGGGTCGTTAAAAAAGTTAACGGCTCCTTTCTCGGGATAAAAGTTTCCACAAAA
ATCAAAGCCATCCTTAAAAACAATATCATCGAACTGGAGGACTGA