SecReT6
Protein ID: 77920399
SecReT6 ID100
T6SS typei2
Gene symbol-
Locus tagPcar_2809
StrainPelobacter carbinolicus DSM 2380
Repliconchromosome [GenBank: NC_007498] [Browse all T6SS(s) in this replicon]
Location [Strand]3275715..3277043 [+]
Producthypothetical protein
NoteTssK
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.80E-112, Aligned region: 16..440
Mo-nitro_C [PF06967], Evalue: 0.0086, Aligned region: 35..87
Mo-nitro_C [PF06967], Evalue: 0.0086, Aligned region: 181..188
Mo-nitro_C [PF06967], Evalue: 0.0086, Aligned region: 244..281
Protein Sequence: 442 a.a.     [Download]
>gi|77920399|ref|YP_358214.1| hypothetical protein Pcar_2809 [Pelobacter carbinolicus DSM 2380]
MSKIVWAEGVFLSQQHFQAWDKQLENSQQLRQFLLNPFSWGIMSLSIDHEALKLGRFQLLEASCIFQDAR
MVHYQSSVHAPLTCDLHSPGGETLGIYLALPANNHVDSISGYPQRSQISGWVADYQEIEDSFDASRKREI
LLAQPNLHLLSDQEALGPFLSIKIAEVLHDGDQRYRVVDSYIPPVCRISGSPALAQRLERIVETLNAKRK
LIEKAREGCDDGTAGFARSDPNNHALLQNLNSRLPRLKHLLNNLDLHPEQLYRQLCQVAGSFCTYHNTAT
IDSIPLYQHEDLTQVFSRLEKLLSLLLELNKTVKNTALVLSKETDHLLSCKDIPTTLFGKETFFIEALFD
AEDPNWIVDFARQVKVTARDSIETCVASALPGVRLVHTQRPPAKLATRSGCEYFRLEPRGDFWNQMIDEG
SMAIYLPCPFNASDIKIVTVEE
 
Nucleotide Sequence: 1329 bp     [Download]
>gi|90960985|ref|NC_007498.2|:3275715-3277043 Pelobacter carbinolicus DSM 2380 chromosome, complete genome
ATGAGTAAAATCGTTTGGGCCGAGGGCGTGTTTCTGAGCCAGCAGCATTTTCAGGCTTGGGACAAGCAAC
TGGAGAACTCTCAGCAACTTCGACAATTTCTGCTTAACCCCTTTTCCTGGGGAATCATGTCCCTATCCAT
CGACCATGAAGCCCTGAAATTGGGCCGTTTCCAGCTGCTCGAAGCCTCGTGCATATTTCAGGATGCTCGC
ATGGTGCACTATCAGAGCTCAGTACATGCGCCCTTGACCTGCGATCTGCACTCACCGGGCGGCGAGACCT
TGGGTATTTACCTGGCATTACCCGCCAACAACCATGTGGATAGCATTTCCGGTTATCCCCAACGCAGCCA
GATCAGTGGCTGGGTTGCCGATTATCAGGAAATAGAAGACAGCTTCGACGCCAGCCGCAAACGAGAAATC
CTTTTAGCTCAGCCCAACCTGCACCTATTGAGTGACCAGGAAGCCCTCGGCCCTTTTTTAAGCATCAAAA
TAGCCGAGGTATTGCATGACGGAGACCAGCGCTACCGAGTTGTCGATAGCTACATCCCCCCTGTATGTCG
CATATCGGGCTCTCCAGCGTTAGCACAGCGTCTGGAACGCATTGTCGAAACCTTGAACGCCAAACGCAAA
CTGATTGAAAAGGCCAGAGAAGGATGCGACGACGGAACGGCAGGGTTTGCCCGCAGCGACCCCAACAACC
ATGCCCTGCTTCAAAATCTCAACAGCAGACTGCCTCGTCTTAAACATCTTTTGAATAACCTTGACCTGCA
TCCAGAGCAGTTATATCGCCAGTTGTGTCAAGTGGCCGGTTCGTTCTGTACCTACCACAATACAGCCACC
ATCGACAGCATTCCTCTCTACCAGCATGAAGATCTGACACAGGTTTTCAGCCGCCTTGAAAAGCTGCTAT
CCCTTCTACTGGAGTTGAATAAAACTGTCAAAAATACCGCCTTAGTGCTCAGCAAAGAAACCGACCATCT
GCTGTCATGCAAAGATATCCCAACAACCCTGTTCGGCAAGGAAACCTTCTTTATCGAGGCCCTGTTTGAC
GCCGAAGACCCAAACTGGATTGTCGATTTTGCACGACAGGTCAAAGTTACAGCCCGCGACAGCATAGAAA
CATGCGTAGCCTCGGCCCTGCCTGGCGTACGACTGGTACACACTCAGCGCCCACCGGCCAAATTGGCCAC
CCGCAGCGGCTGTGAATACTTCCGACTGGAACCCCGGGGGGATTTCTGGAACCAGATGATCGACGAAGGT
TCCATGGCCATCTACCTTCCCTGCCCCTTCAATGCATCTGACATCAAAATCGTCACGGTGGAGGAATAG