SecReT6
Protein ID: 77920400
SecReT6 ID100
T6SS typei2
Gene symbol-
Locus tagPcar_2810
StrainPelobacter carbinolicus DSM 2380
Repliconchromosome [GenBank: NC_007498] [Browse all T6SS(s) in this replicon]
Location [Strand]3277049..3277774 [+]
Producthypothetical protein
NoteTssL
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 8.30E-54, Aligned region: 11..213
Protein Sequence: 241 a.a.     [Download]
>gi|77920400|ref|YP_358215.1| hypothetical protein Pcar_2810 [Pelobacter carbinolicus DSM 2380]
MANDLSTPAYNPILSCSEALFSLIAPIQDDQKASSLGTDFKEQILAAFTSMEKAAFEQQIGMVEFKDAKY
ALAAYVDEMVLNSTWPGHLEWMSRPLQLEFFGEHTAGEGFFTRLANLRQGGEDNLHLLELYYYCLQLGFE
GVYKIKGVEHLMALQVDLRSQIDGYRGPVNSKISPEGLPGHVLINQVRRHVPYWVIAVVTIATVFFTYMG
YAFVSSHVAEASVAKVTKDKDSILKLPEAPY
 
Nucleotide Sequence: 726 bp     [Download]
>gi|90960985|ref|NC_007498.2|:3277049-3277774 Pelobacter carbinolicus DSM 2380 chromosome, complete genome
ATGGCTAACGATTTATCCACGCCAGCATACAACCCAATATTGAGCTGCAGTGAAGCACTCTTTTCGCTAA
TAGCCCCCATACAGGATGACCAGAAGGCATCTTCCCTGGGTACCGATTTTAAAGAACAGATCCTGGCCGC
TTTTACCAGCATGGAAAAAGCGGCATTTGAGCAGCAGATCGGTATGGTCGAATTCAAAGATGCCAAATAT
GCACTGGCCGCGTATGTCGACGAAATGGTTTTAAACTCTACCTGGCCGGGGCATCTGGAGTGGATGTCTC
GCCCTTTGCAACTGGAATTTTTTGGCGAACATACGGCGGGTGAAGGCTTCTTCACCCGGCTTGCCAATCT
GCGTCAGGGAGGCGAGGACAACCTCCATCTACTGGAACTCTACTATTACTGTCTACAGCTTGGATTTGAA
GGGGTTTACAAAATCAAGGGCGTGGAACACCTGATGGCTTTACAGGTCGATTTACGAAGCCAGATAGACG
GTTACCGCGGACCAGTAAACTCCAAGATTTCCCCCGAAGGCCTACCCGGTCACGTCCTCATCAACCAGGT
CAGACGTCATGTCCCTTACTGGGTCATCGCGGTGGTCACCATCGCCACGGTTTTCTTCACATACATGGGC
TACGCTTTTGTTTCGAGCCATGTCGCCGAAGCCAGTGTGGCCAAGGTCACCAAAGACAAAGACAGCATTC
TGAAATTACCGGAAGCCCCATATTGA