SecReT6
Protein ID: 77920403
SecReT6 ID100
T6SS typei2
Gene symbol-
Locus tagPcar_2813
StrainPelobacter carbinolicus DSM 2380
Repliconchromosome [GenBank: NC_007498] [Browse all T6SS(s) in this replicon]
Location [Strand]3282417..3283943 [+]
Producthypothetical protein
NoteTssA
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 8.20E-18, Aligned region: 49..109
Protein Sequence: 508 a.a.     [Download]
>gi|77920403|ref|YP_358218.1| hypothetical protein Pcar_2813 [Pelobacter carbinolicus DSM 2380]
MTPLPPKPNPEWLLDIARPLQDKVCGDDPRYLDAFQRIKEESDKLRDVDYAMIMATCRELLAKEAKDLRI
AGYYLVAAAYIEGLPGLLDGLKMYRVLLQNFWCDCHPQSASGRRAALNLLANPRLVAFAERSETPVSLEI
LVNLHQEIDGIHLFLTEKLGEETPRLSRLAPWVEERLRRLKPTTPKGDPPSQATAQQPAPSDTTESTQEL
NSEHGVEFLTRQIHKYLLNSGDFLRALAYSRALRWGKLALPPHDQGRTRIPAPRASGLTQLENTLTCDSL
DQALTCSENLFFEPGFQLLFDLQFHLFQYLEANHQPDLACFVRNALRAPLDRHPELLNLQFDDGRPFAGT
ECLLWIQQWQTSGVNSPSRGPLNEGPDEISVKTLVDDAMQLAKRKKLPEALQNIQSLPCQTEKQRIQKRL
AEARLCLTAGKADMAEVVLADMQQYILAHHLPLWDPALAVAVLQQRLTVLQALEKASPGERKQHLTQQRH
ELRQLLCKIDVISAAAFI
 
Nucleotide Sequence: 1527 bp     [Download]
>gi|90960985|ref|NC_007498.2|:3282417-3283943 Pelobacter carbinolicus DSM 2380 chromosome, complete genome
ATGACCCCCCTCCCCCCAAAGCCAAACCCGGAATGGCTCCTCGACATCGCCAGGCCCCTGCAAGATAAAG
TCTGCGGCGATGATCCCCGCTACCTGGACGCATTTCAGCGAATCAAGGAAGAAAGCGACAAGCTTAGGGA
TGTCGACTATGCCATGATCATGGCCACCTGCCGCGAGCTACTGGCCAAGGAGGCAAAAGATCTGCGCATT
GCAGGATATTACCTTGTGGCCGCAGCCTACATCGAAGGACTGCCGGGGCTGCTGGACGGGCTGAAAATGT
ACCGGGTGCTGCTGCAAAACTTCTGGTGCGACTGCCATCCCCAAAGCGCGTCGGGGCGACGGGCTGCCCT
CAATCTGCTGGCTAATCCGCGGCTGGTAGCATTTGCCGAACGTTCAGAGACGCCGGTCTCCCTCGAAATA
TTAGTCAACCTGCACCAGGAAATCGATGGTATCCACCTGTTTCTCACAGAAAAACTGGGAGAGGAAACAC
CCCGTCTCTCGCGCCTGGCACCTTGGGTCGAGGAGCGATTGCGGAGGCTTAAGCCCACAACACCGAAAGG
AGATCCTCCCTCCCAGGCCACAGCACAACAACCGGCTCCCAGCGACACCACGGAATCTACCCAAGAGCTC
AACTCCGAGCATGGAGTGGAATTCCTGACACGTCAGATTCACAAATACTTACTCAACTCCGGCGATTTTC
TTCGGGCGTTGGCCTATTCCCGGGCGTTGCGATGGGGAAAACTGGCTCTTCCCCCCCACGACCAAGGGCG
AACCCGCATTCCGGCACCGCGTGCCAGCGGCCTAACTCAACTCGAAAACACTCTGACTTGTGATTCACTG
GATCAGGCCCTGACATGCAGTGAAAACCTGTTTTTTGAGCCGGGTTTCCAGTTGCTGTTTGATCTTCAAT
TCCACCTGTTCCAATACCTCGAGGCCAATCATCAACCGGATCTGGCCTGCTTCGTCCGGAATGCATTGCG
CGCTCCTCTGGATCGACACCCGGAATTGCTGAATCTGCAATTTGATGACGGCCGCCCCTTTGCCGGCACC
GAATGCCTTCTGTGGATTCAGCAATGGCAGACAAGCGGCGTCAACAGCCCAAGCCGAGGCCCCCTCAACG
AGGGCCCCGATGAAATTTCGGTTAAGACACTGGTTGACGACGCCATGCAATTGGCAAAACGGAAGAAATT
GCCAGAGGCCCTTCAGAACATTCAGAGCCTGCCCTGCCAAACCGAAAAACAGCGCATACAAAAACGTCTT
GCAGAAGCCCGACTATGCCTGACAGCAGGTAAAGCCGACATGGCCGAAGTGGTCCTGGCAGACATGCAGC
AATACATCCTGGCTCATCATCTGCCCCTCTGGGACCCCGCCCTGGCAGTTGCGGTGTTGCAGCAACGGCT
CACCGTCTTGCAAGCTCTGGAAAAGGCTAGCCCTGGCGAAAGGAAACAGCACCTTACACAACAACGACAT
GAACTGCGGCAGTTACTCTGCAAAATCGATGTTATCTCTGCCGCTGCTTTCATCTGA