SecReT6
Protein ID: 77920404
SecReT6 ID100
T6SS typei2
Gene symbol-
Locus tagPcar_2814
StrainPelobacter carbinolicus DSM 2380
Repliconchromosome [GenBank: NC_007498] [Browse all T6SS(s) in this replicon]
Location [Strand]3284003..3284530 [+]
Producthypothetical protein
NoteTssB
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.40E-54, Aligned region: 6..159
Protein Sequence: 175 a.a.     [Download]
>gi|77920404|ref|YP_358219.1| hypothetical protein Pcar_2814 [Pelobacter carbinolicus DSM 2380]
MSDSYQKEIPKARINLALDVETGGHQKKTELPLKMLVMGDFSNGKTKGKIADRQRININKNNFESVMADL
APSVRFDVPNLLAKDGSDFSIDLAFQSMKDFRPDSVAHQIPEMHSLMAMRNLLKDLKSNLLDNAKFRKKL
EKIVSNQPQLEGLKQQLEKLLDDSNETSNLEIRSY
 
Nucleotide Sequence: 528 bp     [Download]
>gi|90960985|ref|NC_007498.2|:3284003-3284530 Pelobacter carbinolicus DSM 2380 chromosome, complete genome
ATGAGCGACAGTTACCAAAAGGAAATCCCTAAGGCCCGTATCAATTTAGCGCTGGATGTTGAAACCGGGG
GTCACCAGAAAAAGACGGAACTTCCCTTGAAAATGCTGGTGATGGGGGATTTCAGCAACGGCAAAACCAA
GGGGAAAATAGCCGACCGACAGCGGATCAACATCAACAAGAACAATTTCGAATCGGTCATGGCCGATCTC
GCTCCGAGTGTCCGCTTCGACGTACCGAATCTGTTGGCCAAGGACGGCAGCGATTTTTCCATCGATCTCG
CCTTTCAGTCGATGAAGGATTTCCGCCCGGACAGCGTAGCGCATCAGATTCCCGAGATGCACAGCCTGAT
GGCGATGCGAAATCTGCTAAAGGATCTAAAATCGAACCTGCTGGACAACGCCAAGTTTCGCAAGAAGCTG
GAAAAGATCGTCAGCAACCAGCCTCAACTGGAAGGTTTGAAGCAGCAATTGGAAAAGTTGCTGGATGATT
CCAATGAAACGTCCAACCTGGAAATCCGCAGCTACTAA