SecReT6
Protein ID: 77920405
SecReT6 ID100
T6SS typei2
Gene symbol-
Locus tagPcar_2815
StrainPelobacter carbinolicus DSM 2380
Repliconchromosome [GenBank: NC_007498] [Browse all T6SS(s) in this replicon]
Location [Strand]3284548..3286089 [+]
Producthypothetical protein
NoteTssC
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 6.80E-177, Aligned region: 87..509
Protein Sequence: 513 a.a.     [Download]
>gi|77920405|ref|YP_358220.1| hypothetical protein Pcar_2815 [Pelobacter carbinolicus DSM 2380]
MNMQNTAPSKSKPQEEVLLDNENSYERLCELVDIAPLNESIKLNSFADASRMADISLQERLTAGIQVFLD
LATRNNSQIERIDKTLLDQYIAQIDQTIGNQLDVILHHLDFQKMESAWRGLQFMVDRCDFRCNTKVEILD
CSKEDLLEDFEEAPEIIQTGLYKHVYVSEYDTPGGQPFSNIVANFEFDSSAQDVTLLREASKVSASAHCP
FLASVGSKFFGKSSVEEIAKINDLSNYMEKAEFTRWRSFRETEDSRYVGLLTPRFLLRLPYGQDTIPVRT
FNYEENVSAEDHRSYLFGNPVFAFAGNIAQSFAKHGWAVNIRGPEAGGKVENLPVHLHDSGKGMQIKMPT
EMLVSETRELEMANLGFIPLSYYKNSDFACFFSANSVQKPSEYANTEANANSMINARLPYIFLVSRLAHY
LKVLQRENIGSSKSRQKLENELNAWIQTLVTKMKDPEPELIATHPLRDGQVTVREIPENPGYYSVDLFVR
PHFQIEGVDVQLKLVAQMPRDNK
 
Nucleotide Sequence: 1542 bp     [Download]
>gi|90960985|ref|NC_007498.2|:3284548-3286089 Pelobacter carbinolicus DSM 2380 chromosome, complete genome
ATGAACATGCAGAATACGGCACCGAGCAAAAGCAAACCTCAAGAAGAAGTCCTTCTTGACAACGAGAACT
CCTACGAACGTTTATGCGAGCTGGTCGACATCGCTCCCCTGAACGAATCGATCAAACTGAACAGCTTTGC
CGACGCGTCCCGAATGGCGGATATTTCCCTGCAGGAACGGCTGACGGCCGGCATCCAGGTGTTTCTCGAC
CTGGCAACCCGGAACAATTCCCAGATCGAACGGATCGACAAAACCCTGCTCGACCAGTACATCGCCCAGA
TCGATCAGACCATCGGCAATCAACTGGATGTCATTCTTCACCACCTGGATTTTCAGAAGATGGAGAGTGC
CTGGCGCGGCCTTCAATTCATGGTCGACCGCTGTGACTTCCGCTGCAACACCAAAGTGGAAATCCTCGAC
TGCTCCAAGGAGGATCTGCTGGAGGACTTCGAGGAAGCCCCCGAAATCATCCAGACCGGTCTCTACAAGC
ATGTCTATGTCAGCGAATACGACACGCCCGGCGGTCAGCCCTTTTCCAACATTGTCGCGAACTTCGAATT
CGACAGCTCGGCCCAGGACGTCACCCTGCTGCGCGAAGCCTCCAAGGTTTCGGCCAGTGCCCACTGCCCC
TTCCTGGCGTCGGTCGGTTCGAAATTTTTCGGCAAATCCAGCGTCGAGGAAATCGCCAAGATCAACGACC
TGTCCAACTACATGGAAAAGGCCGAGTTCACCCGCTGGAGAAGCTTCCGCGAAACGGAAGACAGCCGCTA
CGTGGGTCTGCTGACTCCCCGATTCCTGCTGCGCCTGCCCTACGGCCAGGACACCATTCCGGTCCGCACC
TTCAATTATGAAGAAAACGTCAGCGCCGAGGACCACCGCAGCTATCTGTTCGGCAACCCGGTCTTCGCCT
TCGCCGGCAACATCGCCCAGAGCTTCGCCAAACACGGCTGGGCCGTCAACATCCGCGGTCCGGAAGCCGG
AGGGAAAGTTGAAAATCTGCCGGTGCACCTGCACGACAGCGGGAAGGGCATGCAGATCAAGATGCCCACG
GAAATGCTGGTTTCCGAAACCCGCGAACTGGAAATGGCCAACCTCGGCTTCATCCCCCTGAGCTATTACA
AAAACAGCGACTTCGCCTGCTTTTTCTCCGCCAACTCGGTGCAGAAACCGAGCGAGTACGCCAACACCGA
GGCCAACGCCAACAGCATGATCAACGCGCGGCTGCCCTACATCTTCCTGGTGTCGCGGCTCGCTCATTAT
CTCAAGGTCCTGCAGCGGGAAAACATCGGCTCGTCCAAGAGCCGCCAGAAACTGGAAAACGAACTGAACG
CCTGGATCCAGACCCTGGTGACGAAAATGAAGGACCCCGAGCCGGAACTGATCGCCACCCACCCCCTGCG
GGACGGCCAGGTAACGGTGCGGGAAATCCCGGAAAACCCGGGCTACTACAGCGTCGACCTGTTTGTCCGG
CCGCATTTCCAGATCGAGGGGGTGGACGTGCAGTTGAAACTCGTGGCGCAGATGCCGCGGGATAATAAAT
AA