SecReT6
Protein ID: 77920406
SecReT6 ID100
T6SS typei2
Gene symbol-
Locus tagPcar_2816
StrainPelobacter carbinolicus DSM 2380
Repliconchromosome [GenBank: NC_007498] [Browse all T6SS(s) in this replicon]
Location [Strand]3286337..3286822 [+]
Producthypothetical protein
NoteTssD
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.40E-36, Aligned region: 6..146
Protein Sequence: 161 a.a.     [Download]
>gi|77920406|ref|YP_358221.1| hypothetical protein Pcar_2816 [Pelobacter carbinolicus DSM 2380]
MAIPGYMTILDDQGSKVEGPVKVAGREGTIEILGFDHELRIPTDNDTGSLTGTRKHEPFVFLKAFDNATP
YLYKACSNGQTLKRIDLKWYRINDTGTEEEYFRHTLENVKLTSVKPTMHNVKDLDKERYPHLEAVACRYA
KITWTYIDGNISFSDSWTEGR
 
Nucleotide Sequence: 486 bp     [Download]
>gi|90960985|ref|NC_007498.2|:3286337-3286822 Pelobacter carbinolicus DSM 2380 chromosome, complete genome
ATGGCTATTCCCGGCTACATGACCATTCTCGACGATCAGGGTTCCAAGGTAGAAGGGCCGGTCAAGGTCG
CAGGACGCGAAGGAACGATCGAAATCCTCGGCTTCGATCACGAACTGCGCATCCCCACCGACAACGACAC
CGGCAGCCTGACCGGCACCCGCAAGCACGAACCCTTCGTCTTCCTGAAAGCCTTCGACAACGCGACCCCG
TATTTGTACAAAGCCTGCAGCAACGGCCAGACCCTGAAGAGGATCGACCTCAAATGGTACCGCATCAACG
ATACCGGCACCGAGGAAGAATATTTCCGCCACACTCTGGAAAACGTCAAGCTCACCTCGGTCAAGCCGAC
CATGCACAACGTGAAGGACCTGGACAAAGAGCGCTATCCGCACCTGGAAGCGGTGGCCTGCCGCTACGCC
AAGATCACCTGGACCTACATCGACGGCAACATCTCCTTTTCCGACAGCTGGACCGAAGGACGCTGA