SecReT6
Protein ID: 77920407
SecReT6 ID100
T6SS typei2
Gene symbol-
Locus tagPcar_2817
StrainPelobacter carbinolicus DSM 2380
Repliconchromosome [GenBank: NC_007498] [Browse all T6SS(s) in this replicon]
Location [Strand]3286941..3287369 [+]
Producthypothetical protein
NoteTssE
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 6.80E-15, Aligned region: 25..108
Protein Sequence: 142 a.a.     [Download]
>gi|77920407|ref|YP_358222.1| hypothetical protein Pcar_2817 [Pelobacter carbinolicus DSM 2380]
MSQTIFDILTSDPSGESRGELRSSEEDLYLSIRNHLRRLFNSRRGSLTHLPHFGMPDIAALYLELPYTSD
RIMSALRQCVIEFEPRLGHPHVRAIHHEDDRDVTQFELFGETPLGRRVKYIVSLYRTGAVEVATTWEQYT
HG
 
Nucleotide Sequence: 429 bp     [Download]
>gi|90960985|ref|NC_007498.2|:3286941-3287369 Pelobacter carbinolicus DSM 2380 chromosome, complete genome
ATGTCCCAAACTATCTTCGACATCCTGACATCCGATCCCTCCGGCGAATCACGGGGCGAGCTCAGATCTT
CCGAGGAAGATCTGTACCTGAGCATCCGGAATCATCTGCGGCGGCTGTTCAATTCGCGGCGAGGCTCCCT
GACCCATCTGCCGCACTTCGGCATGCCCGATATCGCCGCCCTGTATCTGGAGCTGCCCTACACCAGCGAC
CGGATCATGAGCGCCCTGCGGCAGTGCGTGATCGAATTCGAGCCCCGTCTGGGCCATCCTCATGTCCGCG
CCATTCACCACGAAGATGATCGGGACGTTACCCAGTTCGAACTTTTCGGCGAAACCCCTTTGGGTCGCCG
TGTCAAATATATCGTTTCGCTGTATCGAACCGGCGCCGTCGAGGTGGCCACCACCTGGGAGCAATACACC
CATGGGTAA