SecReT6
Protein ID: 77920408
SecReT6 ID100
T6SS typei2
Gene symbol-
Locus tagPcar_2818
StrainPelobacter carbinolicus DSM 2380
Repliconchromosome [GenBank: NC_007498] [Browse all T6SS(s) in this replicon]
Location [Strand]3287362..3289119 [+]
Producthypothetical protein
NoteTssF
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.00E-166, Aligned region: 3..585
Protein Sequence: 585 a.a.     [Download]
>gi|77920408|ref|YP_358223.1| hypothetical protein Pcar_2818 [Pelobacter carbinolicus DSM 2380]
MGKYFDTEMRLLQEAAQDFARAFPEKARMLGLQDIKDCDPYVERLLEGMAFLTAEVKQRIDDDVPELAEA
LLSHVRPYFLRPFPSCCIMQFSPRPGQMRQTTTLPKGTSLTSKGVTLPDHTRQTVGERVSCSFRTTSDVT
LQPLRLASFQLATAYHGRQEIQLHFQFDHDIAPDQLDLDSIKLYLHGDPATSMALYQALTAQAEEVSVTF
PGEAVRPCVLGRQEAIEPCHLDAENLLVSSSGRGFLGFHLLHEYFCFREKYQFVALRNLNKVSWPKKCCE
FMIHIRLAEALSDEYRLSRENFRLHCAPVINLFESTSEPISLTHKQTEYPVIADTNHPDGILIYSVNGVT
GKQPATGKIHLYSALPSFNHRAGTDRYYHVSHRVREGRRHMTYLSVGGAMTERQEILSCDITACNGAIPR
EHLQVRDIKAPAQEFPSNVTCENITRPSRFLMPPDRPDYRLALVAHLTVSYNSLSSIDSFRQLLSLYDWS
DQEQSGKRIRGLTDIRVSPLNRVYRGALLRGMDIQLSMEESEYISPADTYMFGTILHHFFSMYASINAFV
QTGSRLSPSNSEITWEPLLGENFLI
 
Nucleotide Sequence: 1758 bp     [Download]
>gi|90960985|ref|NC_007498.2|:3287362-3289119 Pelobacter carbinolicus DSM 2380 chromosome, complete genome
ATGGGTAAATATTTCGATACGGAAATGCGACTGCTGCAGGAAGCGGCCCAAGATTTTGCCCGGGCTTTTC
CCGAAAAAGCCCGGATGCTGGGCCTGCAGGATATCAAGGACTGCGATCCCTACGTGGAACGCCTGCTGGA
GGGCATGGCCTTTCTGACGGCCGAGGTCAAACAACGGATCGACGACGATGTGCCGGAACTCGCCGAAGCG
CTTCTGTCTCACGTCCGGCCTTATTTTCTGCGCCCCTTCCCTTCCTGCTGCATCATGCAGTTCAGCCCTC
GTCCCGGCCAGATGAGGCAGACCACGACTCTGCCGAAGGGAACCTCCCTGACCAGCAAGGGGGTAACCCT
GCCGGATCATACCCGGCAGACAGTCGGTGAACGCGTAAGCTGCAGTTTCCGCACCACCAGCGACGTAACC
CTGCAGCCCCTGCGCCTGGCGTCCTTTCAGCTCGCCACCGCCTACCATGGCCGGCAGGAAATCCAGCTCC
ATTTTCAGTTCGACCATGACATTGCCCCGGACCAGTTGGATCTCGACTCGATCAAGCTGTACCTGCACGG
AGACCCAGCGACTTCCATGGCCCTGTACCAGGCCCTGACGGCACAGGCGGAGGAGGTCAGTGTCACTTTC
CCCGGCGAAGCGGTTCGGCCCTGCGTTCTTGGCCGCCAGGAAGCCATCGAACCCTGCCATCTGGACGCCG
AGAACCTGCTGGTGAGTTCATCGGGCCGCGGTTTCCTCGGCTTTCATCTCCTGCACGAATATTTCTGCTT
CCGCGAAAAATACCAGTTTGTGGCCCTACGCAACCTCAACAAGGTGTCGTGGCCAAAAAAATGTTGTGAA
TTTATGATTCACATCCGGTTGGCGGAGGCCTTGTCTGATGAATATCGCCTGAGCAGGGAAAATTTCCGTC
TGCACTGCGCCCCCGTCATCAACTTGTTCGAATCCACCAGCGAACCAATTTCACTGACCCATAAGCAGAC
GGAATACCCCGTGATCGCCGACACCAACCATCCCGACGGGATCCTCATCTACAGCGTCAACGGGGTCACG
GGCAAACAGCCGGCAACGGGCAAGATCCACCTCTATTCCGCGCTGCCTTCCTTCAACCATCGGGCCGGCA
CCGACCGTTACTACCATGTGAGCCATCGCGTCCGAGAAGGGCGCAGGCACATGACTTATCTGTCCGTCGG
CGGGGCCATGACGGAACGACAGGAAATCCTCTCCTGCGACATTACCGCCTGTAATGGGGCTATTCCCCGG
GAACACCTGCAGGTTCGAGACATCAAGGCCCCGGCACAGGAATTTCCGTCCAACGTAACCTGTGAAAACA
TCACCCGGCCCAGCCGGTTTCTCATGCCCCCCGACCGGCCGGACTACCGACTGGCGCTGGTCGCCCACCT
GACGGTCAGCTACAACAGTCTGTCCTCCATCGACAGTTTTCGACAATTGCTGTCCCTGTACGACTGGAGC
GACCAGGAGCAATCGGGCAAGCGCATCCGTGGCCTCACCGATATCCGGGTTTCGCCGCTCAATCGGGTGT
ATCGAGGTGCACTGCTGCGTGGCATGGACATACAACTGTCGATGGAGGAAAGCGAATACATCTCGCCGGC
GGACACCTACATGTTCGGCACCATTCTGCACCACTTCTTCAGTATGTACGCCAGCATCAACGCTTTTGTG
CAAACCGGCTCCCGGCTGAGCCCTTCCAACAGTGAGATAACATGGGAACCATTGCTCGGGGAAAACTTCC
TCATCTGA