SecReT6
Protein ID: 77920409
SecReT6 ID100
T6SS typei2
Gene symbol-
Locus tagPcar_2819
StrainPelobacter carbinolicus DSM 2380
Repliconchromosome [GenBank: NC_007498] [Browse all T6SS(s) in this replicon]
Location [Strand]3289083..3290060 [+]
Producthypothetical protein
NoteTssG
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.20E-69, Aligned region: 18..304
Protein Sequence: 325 a.a.     [Download]
>gi|77920409|ref|YP_358224.1| hypothetical protein Pcar_2819 [Pelobacter carbinolicus DSM 2380]
MGTIARGKLPHLIEDLLKNPSAYSVFQALHLIETNFGEETASGNETQGFIDLAPATEMTFPAGEIRHCRV
DENARYRLELNFMGFYGVDSPLPQFFNDIATFDTPRGAELRGFLELFNQRLYHLLYEAWKKMNLHGSGDG
RTSLYCRYLEALSGGGGTCRVSGRFDYAGILATRVKNSQSLADMLEDFLHCPVTVKQNIPYWIELEERTS
LGSGLALGDNAMLGSRLMDVNSKIRLRIGPLPSRDAADLLPGRRAAATLADMIREYLDPTIQYDLELLIQ
PDAGYESMLGGGQAVLGWTTCLGQAGDKVNRVRLTGGSLDRQRET
 
Nucleotide Sequence: 978 bp     [Download]
>gi|90960985|ref|NC_007498.2|:3289083-3290060 Pelobacter carbinolicus DSM 2380 chromosome, complete genome
ATGGGAACCATTGCTCGGGGAAAACTTCCTCATCTGATCGAGGACCTGCTGAAAAACCCTTCCGCCTACA
GTGTCTTTCAGGCCCTGCACCTGATCGAGACCAACTTCGGGGAGGAAACGGCAAGCGGTAACGAAACACA
GGGATTCATCGACCTGGCTCCCGCCACGGAAATGACCTTTCCGGCCGGCGAAATTCGGCATTGCCGGGTG
GATGAAAACGCCCGTTACCGCCTGGAGCTGAATTTCATGGGGTTCTACGGGGTCGATTCGCCCCTGCCCC
AATTTTTCAACGACATTGCAACATTCGATACGCCGCGCGGCGCCGAATTGCGCGGCTTTCTGGAGCTGTT
CAACCAGCGGCTCTATCACCTGCTCTACGAAGCCTGGAAGAAGATGAACCTCCATGGTTCCGGCGATGGA
CGAACCAGCCTCTATTGCCGATACCTTGAAGCCCTTTCCGGCGGAGGCGGCACCTGCCGGGTTTCGGGAC
GCTTCGACTACGCGGGGATTTTGGCCACCCGAGTCAAAAACAGCCAGTCCCTGGCCGACATGCTGGAGGA
TTTCCTGCATTGCCCGGTAACCGTCAAGCAGAACATTCCCTACTGGATCGAGCTGGAGGAAAGAACGTCG
CTGGGAAGCGGTCTGGCCCTCGGAGACAACGCCATGCTGGGCAGCCGGCTGATGGATGTCAACAGCAAGA
TCCGGCTCCGAATAGGCCCCCTGCCGAGCCGCGATGCGGCCGACCTTCTGCCGGGACGCCGCGCGGCCGC
CACCCTGGCCGACATGATTCGCGAATATCTGGATCCCACGATCCAGTACGACCTGGAGCTGTTGATTCAG
CCGGATGCGGGCTATGAGTCGATGCTGGGTGGAGGCCAGGCGGTTCTGGGCTGGACGACCTGTCTCGGCC
AGGCCGGCGATAAGGTTAATCGCGTTCGGCTTACGGGGGGCAGTCTGGATCGGCAGCGGGAAACATAA