SecReT6
Protein ID: 77920410
SecReT6 ID100
T6SS typei2
Gene symbol-
Locus tagPcar_2820
StrainPelobacter carbinolicus DSM 2380
Repliconchromosome [GenBank: NC_007498] [Browse all T6SS(s) in this replicon]
Location [Strand]3290118..3292817 [+]
Productheat shock protein ClpB-like
NoteTssH
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.90E-39, Aligned region: 227..246
AAA_2 [PF07724], Evalue: 3.90E-39, Aligned region: 602..780
AAA [PF00004], Evalue: 4.80E-21, Aligned region: 229..334
AAA [PF00004], Evalue: 4.80E-21, Aligned region: 607..725
ClpB_D2-small [PF10431], Evalue: 5.70E-16, Aligned region: 786..858
AAA_5 [PF07728], Evalue: 4.90E-15, Aligned region: 229..249
AAA_5 [PF07728], Evalue: 4.90E-15, Aligned region: 606..724
AAA_16 [PF13191], Evalue: 1.30E-12, Aligned region: 62..81
AAA_16 [PF13191], Evalue: 1.30E-12, Aligned region: 206..252
AAA_16 [PF13191], Evalue: 1.30E-12, Aligned region: 274..307
AAA_16 [PF13191], Evalue: 1.30E-12, Aligned region: 464..492
AAA_16 [PF13191], Evalue: 1.30E-12, Aligned region: 597..647
AAA_16 [PF13191], Evalue: 1.30E-12, Aligned region: 670..701
AAA_16 [PF13191], Evalue: 1.30E-12, Aligned region: 758..805
AAA_22 [PF13401], Evalue: 2.80E-10, Aligned region: 228..310
AAA_22 [PF13401], Evalue: 2.80E-10, Aligned region: 604..700
AAA_22 [PF13401], Evalue: 2.80E-10, Aligned region: 756..803
AAA_19 [PF13245], Evalue: 2.90E-07, Aligned region: 226..251
AAA_19 [PF13245], Evalue: 2.90E-07, Aligned region: 604..632
Sigma54_activat [PF00158], Evalue: 4.70E-07, Aligned region: 210..243
Sigma54_activat [PF00158], Evalue: 4.70E-07, Aligned region: 606..723
AAA_17 [PF13207], Evalue: 7.40E-07, Aligned region: 229..291
AAA_17 [PF13207], Evalue: 7.40E-07, Aligned region: 605..642
NACHT [PF05729], Evalue: 8.00E-06, Aligned region: 229..256
NACHT [PF05729], Evalue: 8.00E-06, Aligned region: 606..632
IstB_IS21 [PF01695], Evalue: 1.20E-05, Aligned region: 214..254
IstB_IS21 [PF01695], Evalue: 1.20E-05, Aligned region: 606..625
Arch_ATPase [PF01637], Evalue: 1.80E-05, Aligned region: 208..244
Arch_ATPase [PF01637], Evalue: 1.80E-05, Aligned region: 281..376
Arch_ATPase [PF01637], Evalue: 1.80E-05, Aligned region: 605..645
Arch_ATPase [PF01637], Evalue: 1.80E-05, Aligned region: 677..688
Zeta_toxin [PF06414], Evalue: 1.80E-05, Aligned region: 225..249
Zeta_toxin [PF06414], Evalue: 1.80E-05, Aligned region: 600..646
AAA_18 [PF13238], Evalue: 1.90E-05, Aligned region: 229..251
AAA_18 [PF13238], Evalue: 1.90E-05, Aligned region: 357..393
AAA_18 [PF13238], Evalue: 1.90E-05, Aligned region: 607..633
AAA_25 [PF13481], Evalue: 8.50E-05, Aligned region: 72..87
AAA_25 [PF13481], Evalue: 8.50E-05, Aligned region: 229..252
AAA_25 [PF13481], Evalue: 8.50E-05, Aligned region: 286..324
AAA_25 [PF13481], Evalue: 8.50E-05, Aligned region: 602..633
AAA_14 [PF13173], Evalue: 0.00011, Aligned region: 229..309
AAA_14 [PF13173], Evalue: 0.00011, Aligned region: 605..688
AAA_23 [PF13476], Evalue: 0.0004, Aligned region: 229..246
AAA_23 [PF13476], Evalue: 0.0004, Aligned region: 469..492
AAA_23 [PF13476], Evalue: 0.0004, Aligned region: 604..629
AAA_29 [PF13555], Evalue: 0.00043, Aligned region: 223..245
AAA_29 [PF13555], Evalue: 0.00043, Aligned region: 604..631
NTPase_1 [PF03266], Evalue: 0.00049, Aligned region: 229..254
NTPase_1 [PF03266], Evalue: 0.00049, Aligned region: 283..306
NTPase_1 [PF03266], Evalue: 0.00049, Aligned region: 606..627
RNA_helicase [PF00910], Evalue: 0.00081, Aligned region: 230..252
RNA_helicase [PF00910], Evalue: 0.00081, Aligned region: 607..628
RNA_helicase [PF00910], Evalue: 0.00081, Aligned region: 704..725
AAA_33 [PF13671], Evalue: 0.0012, Aligned region: 229..246
AAA_33 [PF13671], Evalue: 0.0012, Aligned region: 470..520
AAA_33 [PF13671], Evalue: 0.0012, Aligned region: 605..646
TIP49 [PF06068], Evalue: 0.0023, Aligned region: 229..251
TIP49 [PF06068], Evalue: 0.0023, Aligned region: 278..309
TIP49 [PF06068], Evalue: 0.0023, Aligned region: 573..641
TIP49 [PF06068], Evalue: 0.0023, Aligned region: 770..800
T2SE [PF00437], Evalue: 0.003, Aligned region: 177..247
T2SE [PF00437], Evalue: 0.003, Aligned region: 603..684
SRP54 [PF00448], Evalue: 0.0047, Aligned region: 229..267
SRP54 [PF00448], Evalue: 0.0047, Aligned region: 365..395
SRP54 [PF00448], Evalue: 0.0047, Aligned region: 605..652
RuvB_N [PF05496], Evalue: 0.0049, Aligned region: 228..246
RuvB_N [PF05496], Evalue: 0.0049, Aligned region: 300..309
RuvB_N [PF05496], Evalue: 0.0049, Aligned region: 575..627
RuvB_N [PF05496], Evalue: 0.0049, Aligned region: 675..698
DUF815 [PF05673], Evalue: 0.0061, Aligned region: 221..304
DUF815 [PF05673], Evalue: 0.0061, Aligned region: 575..641
AAA_28 [PF13521], Evalue: 0.0072, Aligned region: 229..248
AAA_28 [PF13521], Evalue: 0.0072, Aligned region: 606..630
Protein Sequence: 899 a.a.     [Download]
>gi|77920410|ref|YP_358225.1| heat shock protein ClpB-like [Pelobacter carbinolicus DSM 2380]
MSTAQIKALLDKLNEHCLQALESAAAFAGMRGHFEVCIEHLVVKLLEKGEGDFDLILRHFDVNLDRLWQA
MLDNLSRLRSGNRNKPSFSLQLLEWFERAWTISSLRDPQAQLRSGALLEALLDLAPRLPGTAWLSLEVVS
RNLLQSHLAELIRFSVENPQLPSAAEAVVPSPATASVRSADTATPHLDAYTTDFTARAAKGAIDPVLGRN
DEIRQIIDILTRRRKNNPILVGEPGVGKTAVVEGLALRIAENGVPDSLKKVRLVGLDLGLLQAGAGVKGE
FEKRLKSVIEEIISSPTPIILFIDEAHTLIGAGGDAGQGDAANLLKPALARGELRTLAATTWSEYKKYFE
RDAALERRFQMVKVEEPSQDNAIVMLNGLKGHYQKHHGVLITDSAVEAAVSLSSRYINGRYLPDKAIDLL
DTAAARICMGKAATPAEVDTAREHLTYIERRRKHLAEETAQGIPADVNLLADLQQQEEEARKQLTELEQR
WQAERALVGRIQESRTGGKDALADLATLQRDLQELQKNSPLVQPEVDADTIARVVADWTGVPVGRMVKND
LANLLDFENTLSRRIIGQESAIHAIGQSIRCSKAGLRENQAPIGVFLLTGPSGVGKTETARAIADTLYGG
ERFMVTINMSEYQEAHSVSQLKGSPPGYVGYGEGGILTEAVRQRPYSVILLDEVEKAHPDVLNMFYQVFD
RGFMRDGEGREIDFKNTVLIMTSNLGAETILDLCAPPEPVGEEEEPETPFAPPSHGALIEAARPALTAHF
PAALLARMQIVPLRPLDRDTLRQIIAQKLDKVAQRLFDAHGIRMRCTPEVIDHLVGRCHTPESGARAVNT
LIEQNLLPGISRSLLGFMVNEDMPQLMALEVGENGELECLFSDIVKEDEPQFAQAGAGG
 
Nucleotide Sequence: 2700 bp     [Download]
>gi|90960985|ref|NC_007498.2|:3290118-3292817 Pelobacter carbinolicus DSM 2380 chromosome, complete genome
ATGAGCACCGCACAGATCAAAGCTCTGCTGGACAAACTGAACGAACACTGCCTGCAAGCCCTGGAATCGG
CCGCCGCCTTTGCCGGGATGCGTGGTCATTTTGAAGTCTGTATCGAGCACCTGGTGGTCAAGCTGCTGGA
GAAGGGCGAAGGGGACTTCGACCTGATCCTGCGCCATTTCGACGTCAACCTGGACCGGCTCTGGCAGGCC
ATGCTGGACAACCTCAGCCGCCTGCGGTCCGGCAATCGCAACAAGCCGTCTTTTTCACTCCAGCTTCTGG
AGTGGTTCGAACGGGCCTGGACGATCAGTTCCCTGCGCGACCCCCAGGCCCAACTGCGCTCGGGTGCTCT
GCTCGAAGCCCTGCTGGACCTGGCGCCGCGACTTCCCGGCACGGCTTGGCTGTCCCTGGAAGTCGTATCC
CGCAATCTGCTGCAGTCCCACCTGGCCGAACTGATCCGGTTTTCGGTGGAAAACCCTCAACTACCCAGTG
CAGCCGAAGCCGTAGTGCCATCTCCGGCGACGGCGTCGGTCCGTTCTGCCGACACCGCTACTCCGCACCT
GGACGCCTACACCACCGACTTCACGGCCCGGGCCGCCAAGGGTGCCATCGATCCGGTCCTGGGGCGCAAC
GACGAGATTCGTCAGATCATCGACATCCTGACCCGCCGCCGCAAGAACAATCCGATCCTGGTCGGCGAAC
CCGGCGTCGGCAAGACGGCCGTGGTGGAAGGCCTGGCCCTGCGGATTGCCGAAAACGGGGTGCCGGACAG
CCTGAAAAAGGTCCGTCTGGTCGGGCTGGATCTGGGCCTGCTGCAAGCCGGAGCCGGGGTCAAGGGAGAA
TTCGAAAAACGCCTGAAATCGGTGATCGAAGAGATAATCTCCTCGCCGACTCCGATCATTCTGTTTATCG
ACGAGGCCCACACCCTGATCGGGGCCGGCGGCGACGCCGGCCAGGGCGATGCCGCCAATCTGTTAAAACC
GGCCCTTGCCCGGGGAGAGCTGCGCACCCTGGCCGCCACCACCTGGAGCGAATACAAAAAGTATTTCGAG
CGGGACGCGGCCCTGGAGCGCCGTTTTCAGATGGTCAAGGTGGAGGAACCCTCGCAGGACAACGCCATCG
TCATGCTCAACGGCCTCAAGGGCCATTACCAGAAACATCACGGGGTACTGATCACCGATAGCGCGGTGGA
GGCCGCGGTGAGCCTGTCGAGCCGCTACATCAATGGTCGCTACCTCCCCGACAAGGCCATCGACCTGCTC
GATACCGCCGCCGCCCGGATCTGCATGGGCAAGGCCGCCACTCCGGCAGAGGTGGATACCGCCCGCGAGC
ATCTGACCTATATCGAAAGGCGCCGCAAACACCTGGCCGAGGAAACCGCCCAGGGTATCCCCGCCGACGT
CAACCTGCTGGCCGACCTGCAACAACAGGAAGAGGAGGCCCGCAAGCAATTGACCGAACTGGAGCAACGC
TGGCAAGCGGAACGAGCCCTGGTCGGCCGGATTCAGGAATCCCGTACCGGCGGCAAGGACGCCCTCGCCG
ATCTGGCAACCCTGCAACGGGACCTGCAGGAATTACAGAAAAACTCTCCTCTGGTCCAGCCCGAAGTCGA
CGCCGACACCATCGCCCGGGTGGTGGCCGACTGGACCGGCGTTCCCGTGGGCCGGATGGTAAAAAACGAC
CTGGCCAACCTGCTCGATTTCGAAAATACCCTGAGCCGGCGCATCATCGGCCAGGAGTCCGCCATCCACG
CCATCGGCCAGTCGATTCGCTGCAGCAAGGCGGGCCTGCGGGAAAACCAAGCCCCCATCGGCGTGTTCCT
GCTCACCGGCCCCAGCGGGGTGGGCAAAACCGAAACCGCCCGGGCCATCGCCGACACCCTGTACGGCGGG
GAACGGTTCATGGTGACCATCAACATGAGCGAATACCAGGAGGCCCATTCGGTTTCGCAATTGAAAGGCT
CGCCGCCTGGCTATGTCGGCTACGGCGAGGGCGGCATTCTGACCGAAGCGGTGCGCCAGAGGCCCTATTC
GGTGATCCTGCTCGACGAGGTAGAAAAGGCCCATCCCGACGTACTCAACATGTTTTACCAGGTCTTCGAT
CGGGGCTTCATGCGCGACGGCGAAGGACGGGAAATCGATTTCAAGAACACCGTGCTCATCATGACCAGCA
ATCTGGGCGCCGAAACGATTCTGGATCTGTGCGCTCCTCCGGAACCGGTCGGCGAAGAGGAGGAGCCCGA
AACGCCCTTCGCCCCACCATCCCACGGGGCCTTGATCGAGGCGGCCCGCCCCGCCCTGACGGCTCATTTC
CCAGCGGCGCTGCTGGCCCGCATGCAGATCGTGCCCCTGCGTCCCCTGGATCGGGACACCCTGCGGCAGA
TCATCGCCCAGAAACTCGACAAGGTCGCCCAGCGGCTGTTCGACGCCCACGGCATCCGCATGCGCTGCAC
CCCGGAGGTCATCGACCATCTCGTCGGCCGCTGCCATACCCCCGAATCGGGAGCCCGCGCCGTCAACACC
CTGATCGAGCAAAACCTGTTGCCCGGCATCTCCCGCAGCCTGCTCGGCTTCATGGTCAACGAGGACATGC
CGCAGCTCATGGCTCTCGAGGTTGGCGAAAACGGTGAACTTGAGTGCCTTTTCAGCGACATAGTGAAGGA
GGACGAACCCCAATTCGCCCAGGCGGGGGCAGGTGGATAA