SecReT6
Protein ID: 77920411
SecReT6 ID100
T6SS typei2
Gene symbolvgrE
Locus tagPcar_2821
StrainPelobacter carbinolicus DSM 2380
Repliconchromosome [GenBank: NC_007498] [Browse all T6SS(s) in this replicon]
Location [Strand]3292979..3295051 [+]
ProductRhs element protein VgrE
NoteTssI
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.50E-66, Aligned region: 42..340
Phage_GPD [PF05954], Evalue: 6.50E-66, Aligned region: 515..570
Phage_base_V [PF04717], Evalue: 2.20E-16, Aligned region: 398..472
DUF2345 [PF10106], Evalue: 1.00E-07, Aligned region: 498..586
DUF2345 [PF10106], Evalue: 1.00E-07, Aligned region: 570..684
T6SS_Vgr [PF13296], Evalue: 0.005, Aligned region: 478..518
Protein Sequence: 690 a.a.     [Download]
>gi|77920411|ref|YP_358226.1| Rhs element protein VgrE [Pelobacter carbinolicus DSM 2380]
MTPQNAANLSLNRAANISHFGFRIRSVPDDTFTVTGFSGKDHGISQDFRFTLTLTAQAELTASTVVGNRA
TMEMRWGGTPLFLHGLVDHFSRENDTPEAMCYQVIFTSPLSLLKQNTNNRVFLNRTVPQIIGDILRSAGF
EQDDYAVDLTETYPLREFVIQYAETDFAFLCRLLARSGIFFMFESDAEKSRPRFCDRSAARPALPGVSAL
RYQPQTGTARAVETIYALHSHARLLPGTVRVTDYNYRTPETLLEASQQSAMGAALGENAVYGDHFKTIEE
GQRMASIRAQALDTERMVYVGETDCRGLLPGYRLKITNHPLPAMNDDYLVVSVEHTADQGAALAFGEEAK
GPTYTNRVRLIKAATPYRSPIPKHRQLVGTFTARIETTGTEYAYLDEQGRYHIRVDFDRGDAEAGQASHP
VRLMQPYGGDNYGIHFPLRSGTEVAVTCVNGDPDRPIVTGALPNPQNPNVVTSDNHTQNIIRTVSGNELL
MEDRQGQEKIELFTAERKNILTLDANSDGHKVRLATEEGKMEIAACKTMLIESGDTQTVQSGNDHIVTVE
NSQRMMTRNKEIAYQAATDFRLKAGDNIQFKAEKQNIAMTAGKDMVVDVARSLSMEVRNSDMELLVNRGN
LHIKTARDTSVIGQGGGTITITQQNGTIQITKDGDLAISAGKITIQGNSINLKAGKISEN
 
Nucleotide Sequence: 2073 bp     [Download]
>gi|90960985|ref|NC_007498.2|:3292979-3295051 Pelobacter carbinolicus DSM 2380 chromosome, complete genome
ATGACTCCACAGAATGCCGCCAACCTTTCCCTGAACAGGGCGGCCAACATAAGTCATTTTGGATTCCGGA
TCCGCTCCGTGCCGGATGACACCTTTACCGTAACCGGTTTTTCCGGCAAGGATCACGGTATATCGCAAGA
TTTTCGTTTTACCCTGACGCTCACGGCCCAGGCGGAACTGACGGCTTCGACGGTCGTCGGCAACCGTGCC
ACCATGGAGATGCGATGGGGAGGGACTCCCCTTTTTCTACACGGCCTCGTGGACCACTTTTCCAGGGAAA
ACGATACCCCGGAAGCCATGTGCTACCAGGTCATCTTCACCTCGCCCCTGTCCCTGCTAAAACAGAACAC
CAACAACCGGGTTTTTCTGAATCGCACCGTTCCCCAGATCATCGGCGATATTTTGCGCAGCGCCGGCTTC
GAGCAGGACGACTATGCCGTCGACCTGACCGAAACCTATCCCCTTCGGGAATTCGTGATTCAATATGCCG
AAACCGATTTTGCCTTTCTGTGCCGCCTGCTGGCACGCTCCGGCATCTTTTTTATGTTTGAAAGCGATGC
GGAAAAATCCCGCCCCCGTTTCTGCGATCGAAGCGCGGCACGCCCTGCGTTACCTGGGGTCAGCGCATTG
CGCTATCAGCCGCAAACCGGCACCGCCCGTGCCGTCGAGACCATCTATGCCCTGCATAGCCATGCCCGCC
TGCTCCCTGGTACAGTCCGCGTTACCGACTACAACTACCGAACCCCCGAGACGTTACTCGAAGCCAGCCA
ACAGTCGGCCATGGGTGCCGCCCTCGGCGAAAACGCGGTGTACGGGGATCACTTCAAAACGATTGAAGAG
GGCCAACGCATGGCTTCCATTCGCGCTCAGGCCCTCGACACGGAGCGCATGGTCTACGTGGGAGAGACGG
ACTGCCGTGGACTGCTGCCGGGATACCGCCTCAAGATCACCAATCATCCCCTGCCCGCCATGAACGACGA
CTACCTGGTGGTCAGCGTGGAGCACACGGCCGACCAGGGTGCGGCACTGGCCTTTGGAGAGGAGGCCAAA
GGCCCCACCTACACCAACCGAGTCCGCCTGATCAAGGCCGCAACGCCTTATCGGTCGCCGATTCCCAAGC
ATCGCCAATTGGTCGGGACCTTTACCGCGCGTATCGAGACCACAGGTACCGAATACGCCTATCTCGACGA
GCAGGGGCGATATCATATCCGCGTCGATTTCGACCGGGGCGATGCCGAAGCGGGACAAGCCAGCCATCCG
GTGCGCCTCATGCAACCCTACGGCGGCGACAACTACGGCATCCATTTTCCCCTGCGGTCCGGCACCGAGG
TCGCGGTCACCTGCGTCAACGGCGATCCGGACCGCCCGATTGTGACCGGCGCCCTGCCCAATCCCCAAAA
CCCTAATGTCGTCACCTCCGACAATCACACTCAGAACATCATCCGCACCGTCAGCGGCAACGAACTGCTG
ATGGAGGACCGCCAGGGCCAGGAAAAGATCGAACTCTTCACCGCCGAGCGCAAAAACATCCTCACCCTCG
ACGCCAACAGCGACGGGCACAAGGTCCGTCTGGCCACTGAAGAGGGCAAGATGGAGATCGCGGCCTGCAA
AACCATGTTGATCGAATCGGGCGACACCCAAACGGTGCAGTCCGGAAACGACCACATCGTCACGGTGGAA
AACTCCCAGCGAATGATGACCCGCAACAAAGAGATAGCCTACCAGGCCGCCACCGATTTCCGCCTCAAGG
CCGGGGACAACATCCAATTCAAAGCGGAAAAGCAGAACATCGCCATGACCGCCGGCAAGGACATGGTGGT
GGACGTGGCACGAAGCTTGTCCATGGAAGTGCGCAACAGTGACATGGAGCTGCTTGTGAACCGCGGCAAC
CTGCATATCAAAACCGCAAGGGACACCAGCGTGATCGGCCAGGGCGGCGGCACCATCACGATTACCCAGC
AAAACGGCACCATTCAAATCACCAAAGATGGAGACCTTGCCATTTCGGCCGGCAAGATCACCATCCAGGG
CAACAGCATTAACCTCAAAGCCGGCAAAATCAGCGAAAACTGA