SecReT6
Protein ID: 78047676
SecReT6 ID101
T6SS typei3
Gene symbol-
Locus tagXCV2120
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T6SS(s) in this replicon]
Location [Strand]2431311..2431817 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ3BTR2
KEGG IDxcv:XCV2120
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.50E-55, Aligned region: 11..164
Protein Sequence: 168 a.a.     [Download]
>gi|78047676|ref|YP_363851.1| hypothetical protein XCV2120 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MSVRSSSQKFIARNRAPRVQIEYDVEIYGSQKKVQVPFVMGVLSDLSGANTENLPALEARDAVEIDIDNF
DSRLRAMQPRVAMSVSNTLTGSGELPVDITFDSLDDFSPTAVVKTVAPLAELLEARTQLANLGTYLDGKA
GAERLIADAIKDPTLLRSLVAAPKSTDE
 
Nucleotide Sequence: 507 bp     [Download]
>gi|78045556|ref|NC_007508.1|:2431311-2431817 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGTCCGTTCGCAGCAGCAGTCAGAAGTTCATTGCCAGGAATCGCGCGCCTCGCGTGCAGATCGAATACG
ACGTCGAGATCTACGGCTCGCAGAAGAAGGTGCAGGTTCCGTTCGTCATGGGTGTGTTGTCGGACCTGTC
CGGCGCCAATACAGAAAACCTGCCGGCGCTGGAAGCACGCGATGCAGTGGAAATCGATATCGATAATTTC
GACAGCCGGCTGCGTGCCATGCAACCGCGGGTGGCAATGAGCGTTTCCAACACCCTCACCGGCAGCGGCG
AATTACCTGTCGATATCACCTTCGACAGCCTGGACGATTTTTCGCCCACCGCCGTGGTGAAAACGGTGGC
ACCGCTGGCCGAGCTGCTGGAAGCGCGTACCCAACTGGCCAATCTGGGCACGTATCTCGACGGAAAGGCC
GGCGCCGAGCGCTTGATCGCCGATGCGATCAAGGATCCCACCTTGCTGCGCTCGCTGGTCGCGGCCCCCA
AGTCGACGGATGAGTAA