SecReT6
Protein ID: 78047677
SecReT6 ID101
T6SS typei3
Gene symbol-
Locus tagXCV2121
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T6SS(s) in this replicon]
Location [Strand]2431753..2433327 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ3BTR1
KEGG IDxcv:XCV2121
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 6.00E-193, Aligned region: 93..519
Protein Sequence: 524 a.a.     [Download]
>gi|78047677|ref|YP_363852.1| hypothetical protein XCV2121 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MRSRIPPCCARWSRPPSRRMSNPMATQNSSATQDLADAQPLTSQSDDFAALLTREFRPRSERAGEEVRLA
VRTLAEQVLERSDIISDDLAQTINAYVAEIDRKITEQLNLILHAPHFQALEGAWRGLHYLVSNTESDTQL
KIRVLNVSKKELAKNLKRFKGTAWDQSPVFKKIYEAEYGQLGGEPYGCLIGDYHFDHSPQDVDTLRGISQ
IAAASHAPFIAAAGPGLMGMESWSELSNPRDLAKIFSTPDYAAWRSLRQSEDAKYLALAMPRTLARLPYG
AKTDPVEAFDFEEDTQGADSSRYTWQNAAYAMAVNINRSFKQYGWCTRIRGVESGGAVEGLPTHTFPADD
GGVDMKCPTEVAITDRRSAELDKMGLMPLVHRKNTDMAAFIGAQSLGKPEEYDDPDATANAALSARLPYM
FACCRFAHYLKCIVRDKIGSFSTRQQMQSWLTDWVMNYVDGDPANSSEETKARKPLAAAEVVVEEVEGNP
GYYTSKFYLRPHYQLEGLTVSLRLVSRLPSAQAA
 
Nucleotide Sequence: 1575 bp     [Download]
>gi|78045556|ref|NC_007508.1|:2431753-2433327 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGCGATCAAGGATCCCACCTTGCTGCGCTCGCTGGTCGCGGCCCCCAAGTCGACGGATGAGTAACCCCA
TGGCGACCCAGAATTCTTCCGCTACCCAAGACCTTGCCGATGCCCAGCCGCTAACCAGTCAATCCGACGA
CTTTGCGGCGCTGCTGACTCGCGAATTCCGTCCACGCAGCGAACGCGCCGGCGAAGAAGTGCGGTTGGCT
GTGCGCACCCTGGCCGAACAGGTGCTGGAACGCAGCGACATCATCAGCGACGATCTCGCGCAGACCATCA
ATGCGTATGTTGCCGAGATCGACCGCAAGATCACCGAGCAACTCAACCTCATCCTGCACGCACCGCACTT
CCAGGCGCTGGAGGGTGCATGGCGCGGCCTGCATTATCTGGTGAGCAATACCGAATCGGACACGCAGTTG
AAGATCCGCGTGCTCAACGTGTCCAAGAAGGAGCTCGCCAAGAACCTCAAGCGCTTCAAGGGCACCGCCT
GGGACCAAAGCCCGGTGTTCAAGAAGATCTACGAAGCCGAGTATGGTCAGCTGGGTGGCGAACCGTATGG
CTGCCTGATCGGCGATTACCACTTCGACCACAGCCCGCAGGATGTCGACACGTTACGCGGCATCAGCCAG
ATTGCGGCCGCCTCGCATGCGCCCTTCATCGCCGCTGCGGGTCCCGGACTGATGGGGATGGAAAGCTGGA
GCGAGCTCTCCAACCCGCGCGATCTGGCCAAGATTTTTTCCACACCCGATTACGCGGCATGGCGGTCGTT
GCGCCAGAGCGAGGATGCCAAATACTTGGCGCTGGCCATGCCACGCACGCTGGCACGGCTGCCTTACGGC
GCCAAGACCGATCCGGTGGAAGCGTTCGACTTCGAAGAAGACACCCAGGGCGCCGATTCGTCGCGCTACA
CCTGGCAGAACGCGGCCTATGCGATGGCGGTCAACATCAACCGCTCGTTCAAGCAGTACGGTTGGTGCAC
GCGCATTCGCGGCGTGGAGTCGGGTGGGGCGGTGGAAGGCCTGCCGACGCACACCTTCCCGGCCGACGAC
GGCGGTGTGGACATGAAGTGCCCGACCGAGGTCGCCATCACCGACCGCCGTTCGGCGGAACTGGACAAGA
TGGGCCTGATGCCGCTGGTGCATCGCAAGAACACCGACATGGCCGCCTTCATCGGTGCACAGTCGCTGGG
CAAGCCCGAGGAGTACGACGACCCGGATGCCACCGCCAACGCAGCGCTGAGCGCACGGCTGCCGTATATG
TTCGCCTGCTGCCGTTTCGCCCACTACCTCAAGTGCATCGTGCGCGACAAGATCGGCTCGTTCAGCACGC
GCCAGCAAATGCAGAGCTGGTTGACCGATTGGGTGATGAACTACGTCGACGGCGACCCGGCCAATTCCAG
CGAAGAAACCAAGGCACGCAAGCCCTTGGCCGCCGCCGAAGTGGTGGTCGAAGAGGTCGAGGGTAACCCC
GGTTACTACACCTCCAAATTCTACCTGCGCCCGCATTACCAGCTCGAAGGCCTGACGGTATCGCTACGCC
TGGTCTCGCGCTTGCCATCGGCGCAAGCCGCCTGA