SecReT6
Protein ID: 78047678
SecReT6 ID101
T6SS typei3
Gene symbol-
Locus tagXCV2122
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T6SS(s) in this replicon]
Location [Strand]2433427..2433930 [+]
Producthypothetical protein
NoteTssD
UniProt IDQ3BTR0
KEGG IDxcv:XCV2122
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.20E-36, Aligned region: 7..141
Protein Sequence: 167 a.a.     [Download]
>gi|78047678|ref|YP_363853.1| hypothetical protein XCV2122 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MAFDMHLKFGSGDVEIKGASNHSKHKDEVPIIAWSWGTSNTGNLHTGAGYAAGGKANVQDISVTKYVDSC
SNALLNACCTGARVDSATLYVTNATGEQTDYVTIELSEGVMITSVSTGGSGGEDRLTENVTLHFGKFKYS
FQPQDDKGKKQGGTKDFTFNMQEVKKS
 
Nucleotide Sequence: 504 bp     [Download]
>gi|78045556|ref|NC_007508.1|:2433427-2433930 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGGCTTTCGATATGCATCTCAAATTCGGCTCGGGCGACGTCGAGATCAAGGGCGCGTCCAACCATTCCA
AGCACAAGGACGAAGTGCCGATCATTGCCTGGTCATGGGGCACCAGCAACACCGGCAACCTGCACACCGG
CGCCGGCTATGCGGCCGGCGGCAAGGCCAACGTGCAGGATATTTCCGTCACCAAGTACGTCGACAGCTGC
TCCAACGCCTTGCTCAATGCTTGCTGCACGGGTGCGCGTGTGGATTCGGCCACGTTGTACGTGACCAACG
CCACCGGCGAGCAGACCGACTACGTCACCATCGAGCTGAGCGAGGGCGTGATGATCACCTCGGTGTCCAC
CGGCGGCAGCGGTGGCGAAGATCGTCTGACCGAAAACGTGACGCTGCATTTCGGCAAGTTCAAGTACTCG
TTCCAGCCGCAGGACGACAAGGGCAAGAAGCAGGGCGGCACCAAGGACTTCACCTTCAACATGCAGGAAG
TGAAGAAGTCCTGA