SecReT6
Protein ID: 78047679
SecReT6 ID101
T6SS typei3
Gene symbol-
Locus tagXCV2123
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T6SS(s) in this replicon]
Location [Strand]2433957..2434796 [+]
ProductImpE-like protein
NoteTagJ
UniProt IDQ3BTQ9
KEGG IDxcv:XCV2123
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 2.00E-41, Aligned region: 146..268
Protein Sequence: 279 a.a.     [Download]
>gi|78047679|ref|YP_363854.1| ImpE-like protein [Xanthomonas campestris pv. vesicatoria str. 85-10]
MSMSTVHPEHACARLIKADNPEASLATAKEWVRQCPADAQARIGLFQLLAVVGDWERARQQLLLAADLDQ
AWIGVAGAYACILDAEREREQVLAGRMMPLMPGQVPQWQHDLLQALQHDRDGEPAQAARRRALALTQADA
IAGHVDGERFDWLADADPRFGPCLEVILEAGYAWLPFAQLRSLRFEVPGSLRDMLWQSVEIQWRDGTHSR
GVVPCRYPGSHHSDDGAIRLGKRITWQGEDLSACGLGQRLLAGSEDDYPLLDIRHIAFDTAAVAAPWPN
 
Nucleotide Sequence: 840 bp     [Download]
>gi|78045556|ref|NC_007508.1|:2433957-2434796 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGTCGATGTCCACCGTCCATCCCGAACATGCCTGCGCCCGCCTGATCAAGGCAGACAATCCCGAGGCCT
CGTTGGCCACCGCCAAGGAGTGGGTGCGGCAATGCCCGGCCGATGCCCAAGCGCGCATCGGCTTGTTCCA
ACTGCTGGCCGTGGTGGGCGACTGGGAGCGGGCGCGGCAGCAGTTGCTGCTGGCGGCAGACCTGGATCAG
GCCTGGATCGGCGTGGCTGGCGCGTATGCGTGCATTCTCGACGCCGAACGTGAGCGCGAGCAGGTGCTGG
CCGGTCGGATGATGCCACTGATGCCTGGTCAGGTACCGCAGTGGCAACACGATCTGCTGCAGGCATTGCA
ACACGATCGCGACGGCGAGCCAGCGCAGGCCGCACGACGGCGTGCGCTGGCGCTGACTCAAGCCGATGCC
ATCGCGGGGCACGTCGATGGCGAACGTTTCGACTGGTTGGCGGACGCCGATCCACGGTTTGGGCCTTGCC
TGGAGGTCATCCTCGAAGCGGGCTACGCCTGGCTGCCGTTCGCCCAACTGCGCAGCCTGCGTTTCGAGGT
GCCTGGCAGTCTGCGCGACATGCTGTGGCAATCGGTGGAAATTCAATGGCGCGACGGCACGCACAGCCGT
GGCGTGGTGCCTTGTCGTTACCCCGGCAGCCACCACAGCGACGACGGCGCGATCCGTCTCGGCAAGCGCA
TCACCTGGCAGGGCGAAGACCTGTCTGCCTGCGGTCTGGGGCAACGCCTGCTGGCCGGCAGCGAAGACGA
CTACCCCTTGCTCGATATTCGCCATATTGCATTCGACACCGCCGCGGTGGCAGCGCCATGGCCGAACTGA