SecReT6
Protein ID: 78047680
SecReT6 ID101
T6SS typei3
Gene symbol-
Locus tagXCV2124
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T6SS(s) in this replicon]
Location [Strand]2434784..2435287 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ3BTQ8
KEGG IDxcv:XCV2124
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.30E-19, Aligned region: 37..144
Protein Sequence: 167 a.a.     [Download]
>gi|78047680|ref|YP_363855.1| hypothetical protein XCV2124 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MAELTQQERLQPSLLDRLIDDRRHELAESRDARAIGPAKLRDCVMRDLTWLLNCTRHWHEDALQAYPHVA
TSVLNYGIPDLAGARLAGLDVVELQNRIHAAIVAFEPRLAAASLQVTAKVDTGRMDRMSLSFVIDSELWA
QPLPLALYLRTDLDLETGRFSLSSGAH
 
Nucleotide Sequence: 504 bp     [Download]
>gi|78045556|ref|NC_007508.1|:2434784-2435287 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGGCCGAACTGACCCAACAAGAGCGGCTGCAGCCCTCGCTGCTGGACCGTTTGATCGACGACCGTCGGC
ATGAGCTGGCCGAGAGCCGCGACGCGCGCGCGATCGGTCCGGCCAAGCTGCGCGACTGCGTCATGCGCGA
CCTGACCTGGTTGCTCAACTGCACCCGCCATTGGCATGAGGACGCACTGCAAGCGTATCCGCATGTCGCC
ACCTCGGTGCTCAATTACGGCATTCCCGATCTGGCCGGCGCGCGCCTGGCCGGACTGGACGTGGTCGAGC
TGCAGAACCGTATCCACGCCGCCATCGTGGCGTTCGAGCCGCGGCTCGCTGCGGCCAGCCTGCAGGTCAC
CGCCAAGGTCGATACCGGCCGCATGGACCGCATGTCGCTGTCCTTCGTCATCGACTCCGAACTCTGGGCG
CAGCCATTGCCATTGGCGCTGTATCTGCGCACCGATCTCGACCTGGAAACCGGTCGCTTCAGTCTGTCGT
CCGGAGCGCACTGA