SecReT6
Protein ID: 78047681
SecReT6 ID101
T6SS typei3
Gene symbol-
Locus tagXCV2125
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T6SS(s) in this replicon]
Location [Strand]2435290..2437167 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ3BTQ7
KEGG IDxcv:XCV2125
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.50E-215, Aligned region: 5..625
Protein Sequence: 625 a.a.     [Download]
>gi|78047681|ref|YP_363856.1| hypothetical protein XCV2125 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MDPRLLHHYNRELQHVREMGAEFAQAYPKVAGRLGMSGIECADPYVERLLEGFAFLSARVQLELEAQQPV
FAQHLMDMLYPHFLSPVPSMAVVELQPEQGEGIGPAGHLVPRGSALRSLIGHGDRTACEYRTAHAVTLWP
LRLTAASYLASPAALATLGVPVESRARAGLRLVFTVNAGLRLDMLALDTLPIFITGADGLAGSLYEQLHA
NALGFVVRARAADGQVLSRNFGPEHLQPQGFDDEQALLPRSERSFSGYRLLQEYFACPERFLFAAFDGLA
QVLPRAACTEFEIVVWFDRAVERLDNAVDASNFRLHCTPAINLFPRRGDRIHLQPGICEHHVLADRTRPM
DFEIHGVEQVEGFGDGNTPMQRFEPFYGAQPRSWHERRSAFYALRRQPRRLSTGQRRTGPRSSYVGSEVF
LSLVDGDQAPYPHQLRQLGMQLWCSNRDLPLHMPVGKSSTDFVLDDGGPVAAIRCVAGPTRPRSGVTAGD
TRWRLISHLQLNYLSLLEAGDDGATAVREMLTLYHDPHDAAARRQVEGVRRIASRPIVRRIPVPGPATYG
RGLEITLTCDDAAFEGQGVYLLASVLRHVFARQASLNSFTETVLCTLERNEVVRWPAHLGNRPIL
 
Nucleotide Sequence: 1878 bp     [Download]
>gi|78045556|ref|NC_007508.1|:2435290-2437167 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGGATCCGCGCCTGCTCCACCACTACAACCGCGAGTTGCAGCATGTGCGCGAGATGGGCGCGGAGTTCG
CGCAGGCGTATCCGAAGGTCGCCGGCCGGCTCGGCATGAGCGGCATCGAGTGCGCCGACCCGTATGTCGA
ACGCCTGCTGGAAGGGTTCGCGTTCCTGTCCGCGCGCGTGCAACTCGAATTGGAGGCACAGCAACCGGTA
TTCGCCCAGCACCTGATGGACATGCTGTATCCGCACTTCCTGTCGCCGGTGCCGTCGATGGCCGTGGTGG
AGCTGCAACCGGAGCAGGGCGAGGGCATCGGTCCGGCGGGGCATCTTGTGCCGCGTGGCAGCGCGCTGCG
CTCGTTGATCGGGCACGGCGACCGCACGGCCTGCGAGTATCGTACGGCGCATGCGGTGACGCTGTGGCCG
CTGCGTCTGACCGCCGCCAGCTACCTGGCCTCGCCGGCGGCGCTGGCCACGCTTGGCGTGCCGGTCGAGT
CGCGCGCGCGCGCCGGCCTGCGGTTGGTTTTCACTGTGAATGCCGGGCTGCGTCTGGACATGCTGGCGCT
GGACACACTGCCGATCTTCATCACCGGCGCCGACGGACTGGCCGGCAGCCTCTATGAGCAACTGCATGCC
AATGCGTTGGGATTCGTGGTGCGTGCCCGCGCCGCGGATGGGCAGGTGCTCAGTCGCAACTTCGGCCCCG
AGCATCTGCAGCCACAGGGCTTCGACGATGAGCAGGCATTGCTGCCGCGCAGTGAGCGCTCCTTCAGCGG
CTATCGTCTGTTGCAGGAATACTTCGCTTGCCCAGAGCGCTTCCTGTTCGCCGCCTTCGATGGCCTGGCA
CAGGTGCTGCCGCGCGCGGCGTGCACCGAGTTCGAGATTGTGGTGTGGTTCGATCGTGCCGTCGAACGGC
TCGACAATGCCGTGGATGCGAGCAATTTCCGCCTGCATTGCACCCCGGCCATCAACCTGTTCCCCAGGCG
CGGCGATCGCATCCATCTGCAGCCCGGCATCTGCGAGCATCATGTGCTGGCCGACCGCACGCGGCCGATG
GACTTCGAGATCCATGGCGTGGAGCAGGTCGAGGGCTTCGGCGATGGCAATACGCCGATGCAGCGTTTCG
AGCCGTTCTATGGCGCGCAGCCGCGTAGCTGGCATGAGCGGCGCTCGGCGTTTTATGCGCTGCGGCGTCA
GCCGCGGCGGCTGTCGACCGGGCAACGCCGCACCGGGCCGCGCTCGAGCTACGTCGGCAGCGAAGTGTTC
CTGTCGCTGGTCGATGGCGATCAGGCGCCGTATCCGCATCAGCTGCGGCAATTGGGCATGCAGCTGTGGT
GCAGCAACCGCGATCTGCCGCTGCATATGCCGGTGGGCAAATCCAGCACCGACTTCGTGCTGGACGATGG
CGGCCCGGTGGCGGCGATCCGCTGCGTGGCCGGTCCAACGCGACCGCGCTCGGGCGTGACCGCCGGCGAT
ACCCGCTGGCGCCTGATCAGCCATCTTCAGTTGAACTATCTCTCGCTGCTGGAGGCCGGCGACGACGGCG
CCACCGCAGTGCGCGAGATGCTCACGCTCTACCACGACCCGCACGATGCCGCGGCGCGGCGCCAGGTCGA
GGGCGTGCGCCGCATTGCCTCACGCCCGATCGTGCGCCGCATTCCGGTGCCGGGCCCGGCCACCTATGGC
CGCGGGCTGGAGATCACCTTGACCTGCGACGACGCCGCGTTCGAAGGGCAGGGCGTCTACCTGCTCGCCT
CGGTGCTGCGGCATGTCTTCGCCCGCCAGGCATCGCTGAATTCCTTTACCGAAACCGTGCTGTGCACGCT
CGAACGTAACGAGGTCGTCCGATGGCCAGCCCATCTCGGCAATCGGCCGATCCTGTAG