SecReT6
Protein ID: 78047682
SecReT6 ID101
T6SS typei3
Gene symbol-
Locus tagXCV2126
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T6SS(s) in this replicon]
Location [Strand]2437131..2438141 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ3BTQ6
KEGG IDxcv:XCV2126
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 7.70E-108, Aligned region: 20..321
Protein Sequence: 336 a.a.     [Download]
>gi|78047682|ref|YP_363857.1| hypothetical protein XCV2126 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MASPSRQSADPVALLAHLEAQPQDFELFEALRRLECEHPAQPRLGQAARPLEEPVRLGQRASLEFPPRDI
DSLQPGPDGLPPTLRTLALGLFGPHGALPLHLTEHAIEREGAGDPTFAAFADIFHHRMIALWYRAWADAR
PTVQMDRPGEDRFGARLDALTGVDQPALRGRDAMPLAARRHFAGRFVAQARNAEGLRAVLIGLFDVSVQV
QEFVANWLPLPEEGRLRMGRAAARMGRDATLGASARNAQHRFRLRIGPLEIARYREFLPGGPALEVLTAA
VRGYVGDEQAWDLQLVLAREDVPLPLMGQGQRIGLSLWLGHYRRPRDADQLVLAPS
 
Nucleotide Sequence: 1011 bp     [Download]
>gi|78045556|ref|NC_007508.1|:2437131-2438141 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGGCCAGCCCATCTCGGCAATCGGCCGATCCTGTAGCGTTGCTGGCGCACCTGGAGGCGCAGCCGCAGG
ACTTCGAGTTGTTCGAAGCGTTGCGGCGGCTGGAGTGCGAGCATCCGGCGCAACCGCGTCTGGGCCAGGC
AGCACGGCCGTTGGAGGAGCCGGTGCGCTTGGGGCAGCGCGCCTCGCTGGAGTTCCCGCCGCGCGATATC
GACAGCCTGCAACCGGGCCCGGACGGTCTTCCGCCGACGCTGCGGACGCTGGCCTTGGGTTTGTTCGGCC
CGCATGGCGCGCTGCCGCTGCATCTGACCGAACACGCGATCGAACGCGAAGGGGCTGGTGACCCGACCTT
CGCCGCCTTCGCCGACATCTTCCACCACCGCATGATCGCGCTGTGGTACCGCGCCTGGGCCGATGCGCGC
CCGACCGTGCAGATGGATCGTCCGGGCGAGGACCGCTTTGGCGCGCGGCTGGATGCGCTGACCGGCGTGG
ACCAACCCGCGCTGCGCGGCCGCGATGCGATGCCGTTGGCCGCACGCCGGCACTTCGCTGGCCGCTTCGT
CGCCCAGGCACGCAATGCCGAAGGCCTGCGTGCGGTGCTGATCGGCCTGTTCGATGTCTCCGTGCAGGTG
CAGGAATTCGTTGCCAACTGGTTGCCGTTACCCGAAGAAGGACGGCTGCGGATGGGACGTGCTGCTGCGC
GCATGGGGCGTGACGCCACGCTAGGCGCATCGGCGCGCAACGCCCAACACCGCTTTCGCCTGCGGATCGG
CCCCTTGGAGATCGCCCGCTACCGCGAGTTCCTGCCGGGCGGCCCGGCCCTGGAAGTACTGACCGCCGCA
GTACGCGGCTACGTCGGCGACGAGCAGGCCTGGGACCTGCAATTGGTGCTGGCGCGCGAAGACGTCCCGT
TGCCGCTGATGGGGCAGGGCCAGCGCATCGGCCTGTCGCTCTGGCTCGGCCACTATCGCCGCCCGCGCGA
TGCCGACCAGCTTGTACTCGCACCGTCCTGA