SecReT6
Protein ID: 78047689
SecReT6 ID101
T6SS typei3
Gene symbol-
Locus tagXCV2133
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T6SS(s) in this replicon]
Location [Strand]2444452..2446536 [+]
Producthypothetical protein
NoteTssI
UniProt IDQ3BTP9
KEGG IDxcv:XCV2133
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.90E-73, Aligned region: 72..377
Phage_base_V [PF04717], Evalue: 4.10E-23, Aligned region: 419..512
Protein Sequence: 694 a.a.     [Download]
>gi|78047689|ref|YP_363864.1| hypothetical protein XCV2133 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MAWAGRPTRRRYVWHRDYRFPCTPARPAKSSHAIEPCAYVPQDHSGSLTMAHAITLQSPLGKTLRFVRMS
AHEALGRPYAFVLHGISRDVAIDLRALLGKPMAVKVTSPQGYVRHYHGIVAEAEQTGFEQIEGLRYATYA
FSLVPKLWLLGQRRDCRIYKNKSVPELVRALLADVGCTDVKLRLSASYRPREYCVQYRESGLDFVSRLME
QEGIYYYFEHSASTHTLVLADSLGGHEAVAPFAQIPYCPPGQKGSRMKDAITDWSLARSAHSTRVRLDDY
DYLKPKASLRVNETPAESSGPALGELEVFDYPGEHLDIAAGRRHAQVRAEALNVAQAQYQGWTDACGLQV
GALFKLRDFPLAEHNQEYLVTSANTELVEVDYVSGGETVAEPFASTFRALRSRQPYRSPQTTPRPSIAGL
QTAVVDGKTPEDIAVDQHGRVQVNFFWSPPGTPNAYCSCPVRVAQAWAGKRWGAQHIPRVGQEVVVSFLE
GNPDRPLIIGSVYNADQMPPYALPEHRTRSGVKSRSLLGGAEDYNEIRFDDKKGNEELLLHAQRDLRHEV
ENDHFVTVDRNETAEVKRERSHTVGGNDRLDVGKALRIQAGSEIELVTGMARLQLKASGEIVLSGTRLTL
DGRVSVGIQGGVSVDVSAMANLTLRSNASVLLQSNAVTTARANAALLLQSSGPAVLKGTPPIIA
 
Nucleotide Sequence: 2085 bp     [Download]
>gi|78045556|ref|NC_007508.1|:2444452-2446536 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGGCGTGGGCGGGAAGACCTACTCGTCGACGGTATGTGTGGCATCGCGATTATCGATTTCCCTGCACAC
CAGCGCGGCCGGCAAAGTCATCGCATGCCATCGAGCCCTGCGCCTATGTACCGCAAGACCACTCCGGGAG
CCTGACCATGGCCCATGCCATTACCCTGCAGTCGCCGCTGGGCAAGACGCTGCGCTTTGTGCGGATGAGC
GCGCACGAGGCGCTGGGGCGCCCGTATGCGTTCGTCTTGCATGGCATCAGCCGCGATGTGGCCATCGACC
TGCGCGCTTTGCTGGGCAAGCCGATGGCGGTCAAGGTCACTTCGCCTCAGGGCTACGTGCGGCACTACCA
CGGCATTGTCGCCGAAGCCGAGCAGACCGGTTTCGAGCAGATCGAGGGGCTGCGCTACGCCACCTATGCC
TTTTCGCTGGTGCCCAAGCTGTGGTTGCTCGGGCAGCGCCGCGATTGCCGCATATACAAGAACAAGAGCG
TGCCGGAGCTGGTGCGCGCATTGCTGGCCGACGTTGGCTGCACCGACGTCAAGTTGCGCCTGAGCGCGAG
CTACCGGCCGCGCGAATATTGCGTGCAGTACCGCGAGAGCGGGCTGGACTTCGTCAGCCGGCTGATGGAG
CAGGAGGGCATCTACTACTACTTCGAACACAGCGCCAGCACCCATACGCTGGTGCTGGCCGATAGCCTTG
GCGGCCACGAGGCGGTGGCGCCGTTCGCGCAGATTCCGTACTGCCCGCCCGGACAGAAGGGCAGCCGGAT
GAAGGACGCAATCACCGACTGGTCGCTGGCGCGCAGCGCGCACAGCACGCGCGTGCGGTTGGACGACTAC
GACTATCTCAAGCCCAAGGCGTCGCTGCGGGTGAACGAGACCCCTGCCGAGTCCTCCGGACCGGCGTTGG
GTGAGCTGGAGGTGTTCGACTATCCCGGCGAGCATCTCGATATCGCCGCCGGCCGCCGCCACGCACAGGT
GCGTGCCGAAGCACTCAACGTGGCGCAGGCGCAGTACCAGGGCTGGACCGATGCCTGCGGTTTGCAGGTG
GGCGCGTTGTTCAAGCTACGCGACTTCCCGCTGGCCGAGCACAATCAGGAATACCTGGTGACCAGCGCGA
ACACCGAATTGGTCGAAGTGGATTATGTGTCCGGTGGCGAGACGGTTGCCGAGCCGTTTGCGTCCACGTT
CCGTGCGCTGCGCAGCCGGCAGCCTTACCGCAGCCCGCAGACCACACCGCGTCCCAGCATCGCCGGATTG
CAGACCGCGGTGGTCGACGGCAAGACGCCCGAGGACATCGCGGTCGACCAGCACGGCCGCGTCCAGGTGA
ATTTCTTCTGGAGCCCGCCAGGAACGCCGAACGCCTACTGTTCGTGCCCGGTACGCGTGGCGCAGGCGTG
GGCGGGCAAACGCTGGGGCGCGCAGCACATTCCGCGTGTCGGCCAGGAGGTGGTGGTGAGCTTTTTGGAA
GGCAATCCGGATCGTCCGCTGATCATCGGCAGCGTCTACAACGCCGACCAGATGCCGCCGTATGCACTGC
CCGAGCACCGCACCCGCAGCGGAGTGAAGAGCCGCAGCTTGTTGGGCGGCGCCGAGGACTACAACGAGAT
CCGTTTCGACGACAAGAAGGGCAATGAAGAGCTGCTGCTGCATGCGCAGCGCGATCTGCGCCACGAAGTG
GAGAACGACCATTTCGTCACTGTCGATCGCAACGAGACCGCGGAGGTCAAACGCGAACGCAGCCACACCG
TGGGCGGCAACGACCGTCTGGACGTGGGCAAGGCGCTGCGCATCCAAGCCGGCAGCGAGATCGAGCTGGT
GACCGGCATGGCCCGCCTGCAGCTGAAGGCCAGCGGCGAGATCGTACTCAGCGGCACCCGGCTCACGCTC
GATGGACGCGTCAGCGTCGGCATCCAGGGCGGCGTTAGTGTCGACGTCAGCGCGATGGCCAACCTGACCC
TGCGCTCGAACGCTTCGGTGCTATTGCAATCGAACGCCGTGACCACCGCGCGCGCCAACGCGGCGCTGCT
ATTGCAGTCGTCCGGTCCGGCCGTGCTCAAGGGCACTCCGCCCATCATCGCCTGA