SecReT6
Protein ID: 78047692
SecReT6 ID101
T6SS typei3
Gene symbol-
Locus tagXCV2136
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T6SS(s) in this replicon]
Location [Strand]2448463..2449800 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ3BTP6
KEGG IDxcv:XCV2136
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.10E-152, Aligned region: 19..444
Protein Sequence: 445 a.a.     [Download]
>gi|78047692|ref|YP_363867.1| hypothetical protein XCV2136 [Xanthomonas campestris pv. vesicatoria str. 85-10]
MTPYNKVIWSEGLFLRPQHMQQQERYLERYMELQAGALRPHAWGFSQLELEPELLAIGKLGIRRARGCFP
DGTPFSIPDRDPAPPALDVPANCRDQVVSLALPLRATAQPDSAWPDGDGSRLARYRVGEAEVGDASGSIA
GTVLLEVGVLASRLRLQSEPGEGLVEVPMARIVECRADRRVILDDAFIPTASRIEGAARLSTLLAELLGL
LHQRGQALAERVAGSDRGGVAEIADVLMLQVINRYQPLVAHWASAPLEHPEALYCVLLGMAGELATFTRA
SKRSGPFPPYAHDALQASFEPVVASLRESLSAVLEQSAIAVPLQQRKYGVWVGMVPDPALLDSAAFVLAV
KADLRAEDLRKRLPTESKIGPVEKIRDLVNLQLPGVAVSALAMAPRQVPYHAGCAYFELDRQSSLWKTLR
TSGGVALHFGSGFPGLELELWAVRN
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|78045556|ref|NC_007508.1|:2448463-2449800 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGACCCCCTACAACAAGGTGATCTGGAGCGAGGGCCTGTTCCTGCGCCCGCAGCACATGCAACAACAGG
AGCGCTATCTCGAGCGCTACATGGAACTGCAGGCCGGTGCGCTGCGGCCGCATGCGTGGGGATTCAGCCA
ATTGGAGTTGGAGCCGGAACTGCTTGCCATCGGCAAGCTCGGCATCCGCCGCGCCCGCGGTTGCTTTCCT
GACGGCACGCCGTTTTCCATTCCCGATCGCGATCCGGCGCCGCCAGCCTTGGACGTGCCGGCCAACTGCC
GCGACCAGGTGGTGAGCCTGGCGCTGCCGCTGCGCGCAACCGCCCAACCCGATAGCGCCTGGCCTGATGG
CGATGGCAGTCGGCTGGCGCGGTATCGCGTGGGCGAAGCGGAAGTCGGCGATGCCTCCGGCAGCATCGCC
GGTACCGTGCTGCTGGAAGTGGGCGTGTTGGCCAGTCGCCTGCGCCTGCAGTCCGAACCGGGCGAAGGGC
TGGTGGAGGTGCCGATGGCGCGCATCGTCGAATGCCGCGCCGATCGACGGGTGATTCTCGATGACGCCTT
CATCCCGACCGCCAGCCGGATCGAAGGCGCAGCGCGCCTATCTACGCTGCTGGCCGAGTTGCTGGGACTA
TTGCACCAGCGCGGCCAGGCGCTGGCCGAACGCGTGGCCGGCAGCGACCGGGGTGGCGTGGCGGAAATCG
CCGACGTGCTGATGCTGCAGGTGATCAACCGCTACCAACCGCTGGTGGCGCATTGGGCGAGCGCGCCGCT
GGAGCATCCCGAAGCGCTGTACTGCGTGCTGCTGGGGATGGCCGGCGAACTGGCGACCTTCACCCGTGCC
AGCAAACGCAGCGGGCCATTCCCGCCGTATGCACACGATGCGTTGCAGGCGAGCTTCGAGCCGGTGGTGG
CGTCCTTGCGCGAAAGCCTGAGCGCGGTGCTCGAACAGTCGGCGATTGCCGTGCCCTTGCAGCAACGCAA
GTACGGCGTATGGGTGGGCATGGTGCCCGATCCGGCCTTGCTGGACTCGGCGGCGTTCGTGCTGGCGGTC
AAGGCCGATCTGCGCGCCGAAGACTTGCGCAAGCGGCTGCCCACCGAATCGAAGATCGGCCCGGTGGAGA
AGATTCGCGACCTGGTGAACCTGCAATTGCCAGGGGTGGCCGTGAGCGCGCTGGCGATGGCGCCGCGGCA
GGTGCCGTATCACGCCGGTTGCGCCTACTTCGAACTCGATCGGCAATCGTCGCTGTGGAAGACGCTGCGC
ACCTCCGGTGGCGTGGCGCTGCATTTCGGCAGCGGTTTTCCCGGCCTGGAACTGGAGCTGTGGGCGGTGA
GGAATTGA