SecReT6
Protein ID: 78047693
SecReT6 ID101
T6SS typei3
Gene symbol-
Locus tagXCV2137
StrainXanthomonas campestris pv. vesicatoria str. 85-10
Repliconchromosome [GenBank: NC_007508] [Browse all T6SS(s) in this replicon]
Location [Strand]2449802..2451118 [+]
ProductOmpA family protein
NoteTssL
UniProt IDQ3BTP5
KEGG IDxcv:XCV2137
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.10E-66, Aligned region: 57..262
OmpA [PF00691], Evalue: 1.80E-16, Aligned region: 200..237
OmpA [PF00691], Evalue: 1.80E-16, Aligned region: 329..419
Protein Sequence: 438 a.a.     [Download]
>gi|78047693|ref|YP_363868.1| OmpA family protein [Xanthomonas campestris pv. vesicatoria str. 85-10]
MSNTVDQHDDDATVVRSATPAPRPAAATPARQATTRTVQPPDLDAAMRAAPGAMQGNAVVRAATPLLLLA
VQLRHSTQTPDIATLREHCSTRLQRFEQELRQQGIDDKTGIAARYVLCTLLDEAVLAAPWGEGSGWSQRT
LLVTFHGETYGGAKVFDLLDRLARDPARHLDLLELLYLALALGFGGRYRVEQGGRARLADRQAELYQLIQ
RQRLPAPAELSPNWQGAQAPLLRNTAATPLWIATLASLCIVLLAFVWLHARLNALTAPISAQLARIGLER
VTLPIPAAATPATSAALAPLLAAEQRAGWLTVQTEGDGRSTVRLASASMFPSGSAELDADQTRLLERVAA
ALEQVPGRVVVVGHTDDQPVRSLRFKDNFALSARRAQSVGAVLAAGLRDPRRVQTSGAGDSQPIALPPQL
PGNRARNRRVEILLIPET
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|78045556|ref|NC_007508.1|:2449802-2451118 Xanthomonas campestris pv. vesicatoria str. 85-10 chromosome, complete genome
ATGAGCAATACGGTCGACCAACACGACGACGATGCCACCGTGGTCCGCAGCGCGACGCCGGCGCCGCGGC
CCGCTGCCGCCACGCCGGCTCGCCAGGCGACGACGCGCACCGTGCAACCGCCCGACCTGGATGCCGCCAT
GCGTGCGGCGCCGGGCGCGATGCAGGGCAATGCGGTGGTGCGCGCCGCCACGCCGCTGCTGTTGCTGGCG
GTGCAGTTACGACACTCCACGCAGACGCCGGACATCGCCACCTTGCGCGAACACTGCAGCACGCGCCTGC
AGCGCTTCGAGCAGGAGCTGCGGCAACAGGGCATCGACGACAAGACCGGCATCGCCGCGCGCTATGTGCT
GTGCACGCTGCTGGACGAAGCCGTGCTGGCCGCGCCGTGGGGCGAGGGCAGCGGCTGGTCGCAGCGCACC
TTGCTGGTGACCTTCCACGGCGAGACCTATGGCGGCGCCAAGGTCTTCGACCTGCTCGATCGGCTGGCGC
GCGATCCGGCGCGGCACCTGGACCTGCTGGAGCTGCTGTATCTGGCCTTGGCGCTCGGCTTTGGCGGTCG
CTATCGGGTGGAACAGGGCGGGCGCGCGCGGCTGGCCGATCGCCAGGCCGAGCTGTACCAACTCATCCAG
CGCCAGCGCCTGCCGGCGCCCGCCGAGCTGTCGCCCAACTGGCAAGGCGCGCAGGCACCGTTGCTGCGCA
ATACGGCGGCCACGCCGCTGTGGATCGCGACGCTGGCCTCGCTGTGCATCGTGCTGCTGGCGTTCGTGTG
GTTGCATGCGCGCCTCAATGCGCTGACCGCGCCGATCAGCGCGCAGCTGGCGCGCATCGGCCTGGAGCGG
GTGACGTTGCCGATCCCGGCGGCGGCCACACCCGCAACCAGCGCAGCGCTTGCACCGCTGCTGGCCGCCG
AGCAACGCGCAGGATGGCTGACCGTCCAGACCGAGGGCGATGGTCGCAGCACGGTGCGGCTGGCCAGTGC
GTCCATGTTCCCCAGCGGGAGCGCGGAGTTGGATGCCGATCAGACCCGCCTGCTCGAACGCGTTGCTGCG
GCGCTGGAACAGGTGCCGGGGCGGGTGGTGGTGGTGGGACATACCGACGACCAACCGGTGCGCTCGCTGC
GCTTCAAGGACAACTTCGCCTTGTCGGCGCGCCGCGCCCAGAGCGTGGGCGCCGTGTTGGCGGCCGGCTT
GCGCGACCCGCGCCGCGTCCAGACCAGCGGCGCGGGCGATTCCCAGCCCATTGCGTTACCGCCGCAGCTG
CCCGGCAACCGTGCGCGCAATCGGCGCGTCGAAATCCTGTTGATTCCCGAGACCTGA